KEGG   Ralstonia solanacearum GMI1000: RSc2976Help
Entry
RSc2976           CDS       T00071                                 

Gene name
mrcA
Definition
(GenBank) probable penicillin-binding 1 (peptidoglycan synthetase) transmembrane protein
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00550  Peptidoglycan biosynthesis
rso01100  Metabolic pathways
rso01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    RSc2976 (mrcA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    RSc2976 (mrcA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rso01003]
    RSc2976 (mrcA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
    RSc2976 (mrcA)
Enzymes [BR:rso01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     RSc2976 (mrcA)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     RSc2976 (mrcA)
Glycosyltransferases [BR:rso01003]
 Polysaccharide
  Bacterial polysaccharide
   RSc2976 (mrcA)
Peptidoglycan biosynthesis and degradation proteins [BR:rso01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   RSc2976 (mrcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB BetaGal_dom3
Motif
Other DBs
NCBI-ProteinID: CAD16685
UniProt: Q8XV55
LinkDB All DBs
Position
3208628..3211033
Genome map
AA seq 801 aa AA seqDB search
MATAQTAPASPKPPKARRPLWLRLILWMLGLFVAMGVVGALLLGYALLVAAPNLPSLDAI
TDYRPKIPLRVYTADNVLIGEFGEERRSFVPITQMPDVMKRAVLAIEDDRFYEHGGVDFI
GVLRAGLANLHGGLSQGASTITMQVARNFFLSSEKTYTRKIYEMLLSYKIEASLTKDQIL
ELYMNQIYLGQRAYGFASAEQIYFGKNIKDITLAEAAMLAGLPKAPSAYNPVVNPKRAKI
RQEYILQRMRDLHYITPEQYAQAIHEQLPVRGEGHEFDVHAEYVAEMVRQLMYAQYREET
YTRGLNVYTTLRKGDQEVAYESVRRGILDYERRHGYRGPEAFIDLPADADEREQAIDDAL
VEHPNSDDLQSAVVVSAAPKLVRATMLSGETIDLAGDGLRFAQAALSANAQPKIKLRPGA
IIRVIQDPKTGKWSITQLPEVASGFVSLDPQTGGIYSMVGGFDFNRSKFNHVTQAWRQPG
SSFKPFIYSAAVDKGFSPSTVINDAPLSIPTGDTGGQLWEPKNYGGGYDGPMTMRRALQK
SKNLVSVRILRTIGTQYAQQYITRFGFEPDKHPAYLPMALGAGSVTVLQMAGAYSVFANG
GYRVNPYIIDRVTDARGTVIQQTHPMTASKDAVRVIDPRNDFIMDSLLRSVVSGGTGYLA
KQKLGRSDMAGKTGTTNDSFDAWFCGYTPKLVGVAWIGYDNPRSLGDRETGGGLALPIWI
NYMSYALKGQPETERQPPEGVVQMAGDWAYEEYANGQGVASVGLGDALPGGPPASGPEAA
PSLAPTPEQEKQKILDMFRGN
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggctactgcccaaaccgcccctgcctcgcccaagccgcccaaagcccgccgcccgctg
tggctgcgcctgatcctgtggatgcttggcctgttcgtcgccatgggggtcgtgggagcg
ctgctgttgggctatgccctgctggtcgccgcgcccaacctgccgtcgctggatgcgatc
accgactaccgcccgaagatcccgctgcgcgtctacactgccgacaacgtcctgatcggc
gaattcggcgaagagcgccgcagcttcgtgccgatcacgcagatgcccgacgtgatgaaa
cgcgccgtgctcgccatcgaggatgaccgcttctacgagcacggcggcgtcgacttcatc
ggcgtgctgcgcgcggggctggccaacctgcacggcggcctgtcgcagggcgcctcgacc
atcaccatgcaggtggcgcgcaacttcttcctctccagcgagaagacgtacacgcgcaag
atctacgagatgctgctgtcctacaagatcgaggccagcctgacgaaggaccagatcctc
gagctctacatgaaccagatctacctcggccagcgcgcctacggctttgccagcgccgag
cagatctacttcggcaagaacatcaaggacatcacgctggccgaggccgccatgctggcc
gggctgcccaaggcgccgtcggcatacaacccggtggtgaaccccaagcgcgccaagatc
cgccaggagtacatcctgcagcgcatgcgcgacctgcactacatcacgccggagcagtac
gcgcaggccatccacgaacagctgcccgtgcgcggcgagggccatgaattcgacgtgcac
gccgaatacgtggcggaaatggtgcgccagctgatgtacgcgcagtaccgcgaagagacg
tatacgcgcggcctgaacgtctacaccacgctgcgcaagggcgaccaggaagtcgcctat
gaatcggtgcggcgcggcatcctcgactatgagcgccgccacggctatcgcggcccggaa
gctttcatcgacctgcccgccgatgccgacgagcgcgagcaggccatcgacgacgcgctg
gtcgagcaccccaacagcgacgacctgcaatcggccgtggtggtcagcgcggcgcccaag
ctggtgcgggcgaccatgctgtcgggcgagaccatcgacctcgccggcgacggcctgcgg
ttcgcgcaggcggcgctgtcggccaacgcccagcccaagatcaagctgcgcccgggcgcg
atcatccgcgtgatccaggacccgaagacgggcaaatggtcgatcacgcaactgccggaa
gtggcctcgggcttcgtgtcgctcgacccgcagaccggcgggatctattcgatggtcggc
ggcttcgacttcaaccgcagcaagttcaaccacgtcacgcaggcctggcgccagccgggt
tcgagcttcaagccgttcatctactcggcggcggtggacaagggcttctcgccgtcgacc
gtcatcaacgacgcaccgctgtcgatcccgaccggcgacaccggcggccagctgtgggag
ccgaagaactacggcggcggctacgacggcccgatgacgatgcgccgcgcgctgcagaag
tcgaagaacctcgtttccgtgcgcatcctgcggaccatcggtacgcagtacgcgcagcag
tacatcacccgcttcggcttcgagcccgacaagcacccggcctacctgccgatggcgctc
ggcgccggctcggtgacggtgctgcagatggccggcgcatactcggtgttcgccaacggc
ggctaccgcgtcaacccgtacatcatcgaccgcgtgaccgatgcgcgcggcaccgtgatc
cagcaaacccacccgatgacggccagcaaggacgcggtgcgcgtgatcgatccgcgcaac
gacttcatcatggattcgctgctgcgcagcgtggtgtcgggcggcaccggctacctggcc
aagcagaagctgggccgcagcgacatggccggcaagacgggcacgaccaacgattcgttc
gatgcctggttctgcggctacacgcccaagctggtgggcgtggcctggatcggctacgac
aacccgcgcagcctcggcgaccgcgaaaccggcggcggcctggccttgccgatctggatc
aattacatgagctacgcgctcaagggccagccggaaaccgagcgccagccgcccgaaggc
gtggtgcagatggctggcgactgggcctacgaggaatacgccaacggccagggcgtcgcc
tcggtcggcctgggcgatgccctgccgggcggtccgccggcatcgggccccgaagccgcg
ccgagcctggcgccgacgcctgagcaggagaaacagaagattctcgacatgttccgcggc
aactga

DBGET integrated database retrieval system