KEGG   Ralstonia solanacearum GMI1000: RSp0240Help
Entry
RSp0240           CDS       T00071                                 

Definition
(GenBank) putative glycosidase possibly involved in trehalose metabolism protein
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
rso  Ralstonia solanacearum GMI1000
Pathway
rso00500  Starch and sucrose metabolism
rso01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rso00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    RSp0240
Enzymes [BR:rso01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     RSp0240
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     RSp0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C RHH_1
Motif
Other DBs
NCBI-ProteinID: CAD17391
UniProt: Q8XT75
LinkDB All DBs
Position
megaplasmid:complement(305507..308989)
Genome map
AA seq 1160 aa AA seqDB search
MTRNPTVLLVDDALWYKDAVIYQLHVKSFCDSDNDGVGDFPGLISKLDYIAELGVDAIWL
LPFYPSPRRDDGYDIAEYRGVHPDYGTMADARRFIAEAHARGLRVITELVINHTSDQHPW
FQRARRAKAGSALRDFYVWSDHDKKYAGTRIIFIDTEPSNWTWDPVADAYYWHRFYSHQP
DLNFDNPRVLKAVLGVMKFWLNLGVDGLRLDAVPYLVEREGTANENLPETHAVLRKIRAA
MDAEFKNRLLLAEANQWPEDTQEYFGNGDECHMAFHFPLMPRMYMAIAREDRFPITDIMR
QTPEVPPTCQWAIFLRNHDELTLEMVTDAERDYLWEVYASDRRARLNLGIRRRLAPLLER
DRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRDGVRTPMQWSPDRNGGFSRADP
EQLVLPAIMGSLYGYESVNVEAQTRDAHSLLNWTRRLLATRKRHRVFGRGSIQFLQPANR
KVLAYARALEGEAPILCVANLSRASQAVELDLAAYAQRVPVELIGGTAFPPIGQLPYLLT
LPPYAFYWLELRENEPGPSWAQPAAEQLPEFTTLVLRAGLDALADTRQREAHRQLVEREI
LPTYLPKRRWFAAKDSVLRGAHFAWGTELPVDAASTNRPLAGATRPEVFINEIAVTLGDA
DGTERTERYLLPLSIAWESATLPALPIQLALARVRRGRHVGYLTDAFTTETFARVLLANL
VRGVTLEASDGRVHFEPEPHLAELAEPPVAAETAAVRPAPLPLAPDAPVQWLAAEQSNSS
LVIGESVIVKLIRRVAAGVHPEVEMTRHLTRIGYANTAALIGEIAHEGADGERSTLAVLQ
SFVPNQGDAWTWALDYLRRTIDELAVLTEAVSAGDGDAAPTAVSEARTDTDEALAGYLAF
IGAIGTRLGELHVALAGPSDDPAFGTRAADADDAAFWTARVDEELARALDHLAAWQAANG
PRAEVGWLLSQRDALLEAARERAQGGLGAMLARVHGDFHLGQVLVAQGDAYLIDFEGEPS
RPVDERRRKTSPLRDVAGLVRSLDYVVGAMRQGPEHVAGPAQERRDQLLERFRNASTERF
LEAYAAAILASGSDDGACMLDLDLLDLFLLEKAAYEVNYEAANRPTWLPIPLAGLARVAR
RLLPADVAPPVARDPLGGPP
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgcaacccgaccgtgctgctggtggacgacgcgctctggtacaaggacgcggtc
atctatcagctgcacgtcaaatcgttctgcgactcggacaacgacggcgtaggggacttc
ccgggcctgatctccaagctcgactacatcgccgagctgggcgtggatgcgatctggctg
ctgccgttctacccctcgccgcgccgcgacgacggctacgacatcgccgaataccgcggc
gtgcaccccgactacggcaccatggccgacgcgcgccgcttcattgccgaggcgcacgcg
cgcggcctgcgcgtcattaccgagctggtcatcaaccacacctcggaccagcacccgtgg
ttccagcgcgcgcggcgcgccaaggcgggctccgcgctgcgcgacttctacgtgtggtcg
gaccacgacaagaaatacgccggcacgcgcatcatcttcatcgacaccgagccctccaac
tggacctgggacccggtggccgacgcctactactggcaccgcttctattcgcaccagccc
gacctgaacttcgacaacccgcgcgtgctcaaggccgtgctgggcgtgatgaagttctgg
ctcaacctgggcgtggacggcctgcggctcgatgccgtgccctacctggtggagcgcgag
ggcaccgccaacgagaacctgcccgagacgcacgccgtgctgcgcaagatccgcgcggcg
atggacgcggaattcaagaaccgcctgctgctggccgaagccaaccagtggcccgaagac
acacaggaatacttcggcaacggcgacgagtgccacatggccttccactttccgctgatg
ccgcgcatgtacatggcgatcgcgcgggaggaccgcttcccgatcaccgacatcatgcgg
cagacgcccgaggtgccgcccacctgccagtgggccatcttcctgcgcaaccacgacgag
ctgacgctggagatggtgaccgacgcggagcgcgactacctgtgggaggtctacgccagc
gaccgccgcgcgcggctcaatctcggcatccgccggcgcctggcgccgctgctggagcgc
gaccgccgccgcgtggagctgatgaacagcctgctgttctcgatgcccggcacgccggtg
atgtattacggcgacgagatcggcatgggcgacaacatccacctgggcgaccgcgacggc
gtgcgcacgccgatgcagtggtcgcccgaccgcaacggcggcttctcgcgcgccgatccg
gagcagctggtgctgccggccatcatgggctcgctgtacggctatgaatcggtcaacgtg
gaggcgcagacgcgcgacgcgcattcgctgctgaactggacgcgccggctgctggccacg
cgcaagcgccaccgcgtgttcgggcgcggcagcatccagttcctgcagccggccaaccgc
aaggtgctggcctatgcgcgcgcgctggaaggcgaggcccccatcctgtgcgtggcgaat
ctgtcccgggcctcgcaggcggtggagctggacctggccgcctatgcgcagcgcgtgccg
gtggagttgatcggcgggacggccttcccgccgatcggccagttgccctatctgctgacg
ctgccgccctatgcgttctactggctggagctgcgcgagaacgagcccggcccgtcgtgg
gcgcagccggccgcggagcagttgcccgagttcaccacgctggtgctgcgcgcggggctc
gatgcgctggccgacacacgccagcgcgaggcgcaccgccagctggtcgagcgcgagatc
ctgccgacctacctgcccaagcgccgctggttcgcggccaaggacagcgtgctgcgcggc
gcgcacttcgcctggggcaccgagctgccggtggatgcggcctccaccaaccggccgctg
gcgggggcgacccggcccgaggtgttcatcaacgagatcgccgtcacgctgggcgacgcg
gacggcaccgagcgcaccgagcgctacctgctgccgctgtcgatcgcgtgggagagcgcc
acgctgcccgcgctgccgatccagctggcgctggcgcgcgtgcggcgcggccgccatgtc
ggctacctgaccgatgccttcaccaccgagaccttcgcccgtgtgctgctggccaacctg
gtgcgcggcgtcacgctggaggccagcgacggccgcgtgcatttcgagcccgagccgcac
ctggccgaactggccgagccgccggtggccgccgaaaccgcggcggtgcgcccggcgccg
ctgccgctggcgcccgacgcgccggtgcagtggctggcggcggagcagtccaacagctcg
ctggtgatcggcgaatcggtcatcgtcaagctgatccgccgggtggcggcgggtgtgcat
ccggaagtggagatgacgcgccacctcacgcgcatcggctatgccaacacggccgcgctg
atcggcgagatcgcgcacgagggcgcggacggcgagcgcagcacgctggccgtgctccag
agcttcgtgcccaaccagggcgatgcgtggacatgggcactcgactacctgcgccgcacc
attgatgagctggcggtgctgacggaggccgtctcggccggcgacggcgacgcggcgccc
accgccgtctcggaagcgcgcaccgataccgacgaagcgctggcgggctacctggccttc
atcggcgcgatcggcacgcggctaggcgagctgcacgtcgcgctggccgggccgtcggac
gatccggccttcggcacccgcgccgccgacgccgacgacgcagccttctggaccgcgcgc
gtggacgaggagctggcccgcgcgctcgaccacctcgcggcatggcaggcggccaacgga
ccgcgcgccgaggtcggctggctgctgtcgcagcgcgatgccctgctggaagccgcccgc
gaacgcgcacagggcggcctgggcgcgatgctggcgcgcgtccacggcgacttccacctc
ggccaggtgctggtggcgcagggcgatgcctacctgatcgacttcgagggcgagccgtcg
cggccggtggacgagcgccggcgcaagaccagcccgctgcgcgacgtggccgggctggtg
cgctcgctcgactacgtggtgggcgccatgcggcagggccccgagcatgtggccggaccg
gcgcaggagcggcgcgaccagctgctcgaacgcttccgcaatgcgtccaccgagcgcttc
ctggaggcctacgcggccgccatcctggcctccggttccgatgacggcgcctgcatgctc
gatctggacctgctcgacctgttcctgttggagaaggcggcctacgaggtcaactacgaa
gcggccaaccggccgacgtggctgccgatcccgctggcgggcctggcgcgggtggcgcgc
cggctgctgccagcggacgtggcaccgcccgtggcgcgggatccgctcggaggcccgccg
tga

DBGET integrated database retrieval system