KEGG   Ralstonia solanacearum GMI1000: RSp0246Help
Entry
RSp0246           CDS       T00071                                 

Gene name
ahpF
Definition
(GenBank) probable alkyl hydroperoxide reductase (subunit f) oxidoreductase protein
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
rso  Ralstonia solanacearum GMI1000
Brite
KEGG Orthology (KO) [BR:rso00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RSp0246 (ahpF)
Enzymes [BR:rso01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RSp0246 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 Glutaredoxin HI0933_like FAD_oxidored Thi4 FAD_binding_3 AlaDh_PNT_C DAO NAD_binding_8 K_oxygenase FAD_binding_2 FMO-like
Motif
Other DBs
NCBI-ProteinID: CAD17397
UniProt: Q8XT69
LinkDB All DBs
Position
megaplasmid:319171..320745
Genome map
AA seq 524 aa AA seqDB search
MLDADVKAQLKAYLERLVQPIELVASIDDSEGSRDMMDLLRDVAAQSGMIALTEQRDDAE
RKPSFLIRRTGTDVGVRFAAIPTGHEFTSLVLALLQVGGYAPKLDDDVIEQIRNIEGDFR
FETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALFQDEVEARKIMAVPTLFLNGEV
LGQGRMGVEEILAKIDTGAAARDAEKLNARAPYDVLIVGGGPAGAAAAVYAARKGVRTGV
VAERFGGQVLDTMSIENFISVPETEGPKFAAALEQHVRQYNVDIMNVQRAVKLTPADEPG
GLAEVTLANGAVLKGRSIIVSTGARWRNVNVPGEQEYRNRGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVSHVTLLEFGDQLKADAVLVRKLESLPNATILTNAQTTEITGN
GEKVNGLRYRHRTNGAEHDVALEGVFVQIGLVPNTEWLDGVVERNRFGEIIVDARGHTSV
PGVFAAGDSTTVPFKQIIIATGEGAKAALSAFDHLIRVPLAEAA
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgctgatgtcaaggcccaactgaaagcctacctcgaacgccttgtgcagccc
atcgaactggttgcctcgatcgatgacagcgaaggctcccgcgacatgatggacctgctg
cgtgatgtcgccgcgcagtccggcatgatcgcgctcaccgaacagcgcgacgacgccgag
cgcaagccgtcgttcctgatccgccgcaccggcaccgatgtcggtgtccgtttcgcggcc
atcccgaccggccacgagttcacctcgctcgtgctcgcgctgctgcaggtgggcggctac
gcccccaagctcgatgacgatgtcatcgaacagattcgcaacatcgaaggcgatttccgc
ttcgagacctatatgtccctgacgtgccagaactgcccggacgtggtccaggcgctgaac
gtcatgtcggtgatcaacccgcgcatccagcacgtcgccatcgacggcgcgctgttccag
gacgaagtggaagcgcgcaagatcatggccgtgccgaccctcttcctgaacggggaagtc
ctcggccagggccgcatgggcgtggaagagatcctcgccaagatcgacaccggcgccgcc
gcccgcgacgccgagaagctcaacgcccgcgcaccgtacgacgtgctgatcgtcggcggc
gggccggccggcgcggcggcggccgtgtatgccgcgcgcaagggcgtgcgcaccggcgtg
gtggctgagcgcttcggcggccaggtgctcgacacgatgagcatcgagaacttcatctcc
gtgccggagaccgaagggccgaagttcgccgccgcgctggagcagcacgtgcgccagtac
aacgtcgacatcatgaacgtgcagcgcgccgtcaagctcacgccggccgacgagccgggc
ggcctcgccgaggtgacgctggccaacggcgcggtgctcaagggccgctcgatcatcgtg
tcgaccggcgcgcgctggcgcaacgtcaacgtgccgggcgagcaggaataccgcaaccgc
ggcgtggcgtactgcccgcactgcgatggtccgctgttcaagggcaagcgcgtggccgtg
atcggcggcggcaactccggcgtggaagccgcgatcgacctggcgggcatcgtcagccat
gtcacgctgctcgagttcggcgaccagctcaaggccgatgccgtgctggtgcgcaagctg
gaaagcctgcccaacgcgaccatcctcaccaacgcccagaccaccgagatcaccggtaac
ggcgaaaaggtcaacggcctgcgctacaggcaccgcaccaacggcgccgagcacgacgtc
gcgctggagggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctcgacggc
gtggtggagcgcaaccgcttcggcgagatcatcgtcgatgcacgtggccacaccagcgtg
ccgggcgtgttcgcggcgggcgattcgaccacggtgccgttcaagcagatcatcatcgcc
acgggcgagggtgccaaggccgcattgtccgccttcgatcacctgatccgggtgccgctg
gccgaagccgcctga

DBGET integrated database retrieval system