KEGG   Rhodobacter sphaeroides 2.4.1: RSP_0897Help
Entry
RSP_0897          CDS       T00284                                 

Definition
(RefSeq) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    RSP_0897
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsp02000]
    RSP_0897
Enzymes [BR:rsp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     RSP_0897
Transporters [BR:rsp02000]
 Other Transporters
  Pores ion channels [TC:1]
   RSP_0897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C
Motif
Other DBs
NCBI-GeneID: 3718364
NCBI-ProteinID: YP_353980
UniProt: Q3IZF5
LinkDB All DBs
Position
1:2648157..2648774
Genome map
AA seq 205 aa AA seqDB search
MDRLTLYTNPRSRGRIARWMLEEVGQPYDLVTMDYGPEMHTSDYLALNPMGKVPTVTHGS
RVITETAAICAYLADAFPEAGLVPENRASYYRWLFFAAGPFEAAVIDRALGVQIPPERTV
MVGYGDFDRAVATLEHAVSDTPFIAGERFSAADVQVGSQIGWGLQFGTIPDRPAFRAYWE
RLADRPARVRAAAMDDALMAGASHG
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggacaggctcacgctctatacgaacccccgctcgcgcgggcgcatcgcgcgctggatg
ctcgaggaggtcggccagccctacgacctcgtgacgatggattacggccccgagatgcat
acgtccgactatctggcgctcaatccgatgggcaaggttcccaccgtcacgcacgggtcg
cgggtcatcaccgagacggccgcgatctgcgcctatctcgccgacgccttccccgaagca
gggctcgtgcccgagaaccgggcctcctactaccgctggctcttcttcgccgcgggcccc
ttcgaggcggcggtgatcgaccgggcgctcggggtgcagatccctccggagcggaccgtg
atggtgggctacggcgacttcgaccgggccgtggccacgctcgagcacgcggtctcggat
acgcccttcatcgccggcgagcggttcagcgcggccgacgtgcaggtcggttcccagatc
ggctgggggctccagttcggcacgatccccgaccggccggccttccgcgcctactgggag
cggctggcagaccgcccggcgcgggtgcgggcggcagccatggacgatgcgctgatggcc
ggggcctcccatggctga

DBGET integrated database retrieval system