KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2413Help
Entry
RSP_2413          CDS       T00284                                 

Gene name
lig2
Definition
(RefSeq) DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp03030  DNA replication
rsp03410  Base excision repair
rsp03420  Nucleotide excision repair
rsp03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    RSP_2413 (lig2)
   03410 Base excision repair
    RSP_2413 (lig2)
   03420 Nucleotide excision repair
    RSP_2413 (lig2)
   03430 Mismatch repair
    RSP_2413 (lig2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rsp03032]
    RSP_2413 (lig2)
   03400 DNA repair and recombination proteins [BR:rsp03400]
    RSP_2413 (lig2)
Enzymes [BR:rsp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RSP_2413 (lig2)
    6.5.1.6  DNA ligase (ATP or NAD+)
     RSP_2413 (lig2)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     RSP_2413 (lig2)
DNA replication proteins [BR:rsp03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    RSP_2413 (lig2)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     RSP_2413 (lig2)
DNA repair and recombination proteins [BR:rsp03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     RSP_2413 (lig2)
   NER (nucleotide excision repair)
    Other NER factors
     RSP_2413 (lig2)
   MMR (mismatch exicision repair)
    Other MMR factors
     RSP_2413 (lig2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 3720010
NCBI-ProteinID: YP_352475
UniProt: Q3J3R0
LinkDB All DBs
Position
1:complement(1043614..1045215)
Genome map
AA seq 533 aa AA seqDB search
MKRFAALFDLLDRTTRTSAKVAALADYFRTAPEEDRVWTIGLLSGRRPKRAVNTTELRSW
AAEASGLPVWLAEEVHPIVGDLAETISLLLPEPSQTSDRTLDGWMRELVSLTGRPAEVRR
AAILDAWDRLSTPERFLFNKLITGGFRMGVSQGLMTRALAQATGVDEAVLAHRLMGDWKP
SRIGFETLIGAHDPEADASKPYPFALASPVEEVAALGDPADWLAEWKWDGIRGQLVNRAG
AFALWSRGEELVTDRFPDLAPLRDFLPPGLVIDAEVLAWGGEGPLPFAALQKRIGRLTVP
KKILAEAPAHLLAYDLLEENGEDLRAAPLAHRRARLEAVLSALPPGVPISPSPLVAFDDW
ETLGEIRATAREKIAEGLMLKRASSPYFVGRKRGDWWKWKLDPYTVDAVMLYAQQGAGRR
ATLFTDFTFGVRDGDDLVPFTKAYSGLTDAEFRQITDWVRKNTLERFGPVRRVPPELVFE
LAFEGIQASPRHKSGIALRFPRMVRWRKDKPAAEIDTLESLRELLAATGGAAP
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaagcggttcgcggccctcttcgacctgctcgaccgcacgacgcgcacctccgcgaag
gtggcggcgctcgccgactatttccgcaccgcgcccgaggaggaccgggtctggaccatc
ggcctcctctcgggccgccgccccaagcgggcggtgaacacgaccgaactgcgcagctgg
gcggccgaggcatcgggcctgccggtctggctcgccgaggaggtccatccaatcgtgggc
gatctggccgagacgatctcgctcctcctgcccgagcctagccagaccagcgaccgcacg
ctcgacgggtggatgcgcgagctggtttccctcacaggccgcccggccgaggtgcgccgg
gccgccatcctcgacgcctgggacaggctcagcacgcccgagcggttcctcttcaacaag
ctcatcaccggcggtttccgcatgggcgtgagccaggggctgatgacgcgcgcgctggcg
caggcgaccggtgtcgacgaggcggtgctggcgcaccggctgatgggcgactggaagccc
agccggatcggcttcgagacgctgatcggcgcacacgatcccgaggccgatgcctcgaag
ccctatccgttcgcgctcgcctcgccggtcgaggaggtggcggcgctgggagatcccgcc
gactggcttgcggaatggaaatgggatggcatccgcggccagctcgtgaaccgcgcgggc
gccttcgcactctggtcgcgcggcgaggaactggtgacggaccgtttcccggatctcgct
ccgctccgggatttcctgccccccggtctcgtgatcgatgccgaggtgctggcctggggc
ggcgagggtcccctgcccttcgccgcgctccagaagcggatcggccgcctgaccgtgcca
aagaagatcctcgccgaggcgcccgcgcatctgctggcctacgatcttctggaggaaaac
ggcgaggatctgcgcgcggccccgctcgcgcaccgtcgcgcccggctcgaggcggtgctg
tcagccctgcccccgggcgtgccgatctcgccctcgccgctggtggccttcgacgactgg
gagacgctgggcgagatccgcgccacggcgcgcgagaagatcgccgaggggctgatgctg
aagcgcgcctcctcgccctatttcgtcggccgcaagcgcggcgactggtggaaatggaag
ctcgatccctatacggtcgatgcggtcatgctctatgcccagcagggcgcgggccgccgc
gccaccctcttcaccgacttcaccttcggcgtgcgcgacggcgacgatctcgtgcccttc
accaaggcctattccggcctcaccgatgccgagttccgccagatcaccgactgggtgcgg
aagaacacgctggagcggttcggacccgtccggcgcgtcccgcccgagctggtcttcgag
ctggccttcgagggcattcaggccagcccccgccacaagtccggcatcgcgctccgcttc
ccgcgcatggtgcgctggcggaaggacaaacccgcagccgagatcgacacgctcgaaagc
ctgcgcgaactgctcgcagcgacgggcggggcggccccatga

DBGET integrated database retrieval system