KEGG   Rhodobacter sphaeroides 2.4.1: RSP_2679Help
Entry
RSP_2679          CDS       T00284                                 

Definition
(RefSeq) ATP-dependent DNA ligase LigD polymerase module;ATP-dependent DNA ligase LigD phosphoesterase module
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    RSP_2679
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:rsp03400]
    RSP_2679
Enzymes [BR:rsp01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     RSP_2679
DNA repair and recombination proteins [BR:rsp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     RSP_2679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C DNA_primase_S
Motif
Other DBs
NCBI-GeneID: 3720370
NCBI-ProteinID: YP_352735
UniProt: A0A344Q4M9 Q3J300
LinkDB All DBs
Position
1:complement(1323163..1325769)
Genome map
AA seq 868 aa AA seqDB search
MPANPRQDLDRYRAKRDFARTPEPQGRSEAPRPEAESLSFVVQKHAASRLHWDFRLEWNG
VLLSWAVTRGPSPDPSARRLAVRTEDHPLDYAEFEGTIPKGEYGGGTVMLWDRGTWEPQG
DFAEGLRTGQLKIRLAGERMRGRWTLVRMKPRPREKAENWLLIKEHDTHESEQTEELVER
HMTSVATGRTMEQIAAGKAPPRRTRQAALPAFRPLQLARLVSAAPEGEDWIHETKFDGYR
CLAALAGGRARLYTRSGLDWTAKFGALVEDVEALEAQEALIDGEVIAPGREGGSFSELQA
RLKSGGQLLFMTFDLLLLDGEDLTGQPLLARKERLKTLIGKGRGAVRFSGHIRGHGPEVH
ERICAAGLEGIVSKRASAPYAGSRNGDWLKVKCAHRQEFVICGWNASDKPGRPFASLVMG
SYEKSRLVYRGSVGSGFGAPLFRELKPLLAERAQSACPFDRTPAEAKGAHWLKPELVAEV
SFTELTAEGHIRHGVFAGLRSDKDAREVRLEEPAPETPAPRKSGVRKKGTKTARPDAPSP
DEPAPEPARKPRTARGEKKETTMARPDDLRVAGIRISHPDRRIYDRPAVTKREVAEHAEA
LAPRMLRFLKDRPVSLLRCPEGAAAECFFQKHRTRGMPVAMKTVPVETKSGPEDFITLPD
VAALVGATQMGTLEFHIWGSRNRSLQRPDRLVFDLDPDEGLDFAHVRTAAAELRGLLTDL
GLPSVPMLSGGKGVHVIVPLKPKAEWESVKLFSRALATHLAQEAPDRYTATMAKAGRKGR
IFIDWLRNDRGSTAIAPYSLRARPGAPVATPVDWDELASARSGGDWTIRSIRDRLDRPCP
LAEASARPATLGRTVIGRLERLVAGGKP
NT seq 2607 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaacccgcgacaggatctcgaccgctaccgcgccaagcgcgacttcgcgcgc
acgcccgagccgcagggccgttccgaggcgccgcgccccgaggcggagagcctgtccttc
gtcgtgcagaaacatgcagcctcccgtctgcactgggatttccggctggagtggaacggt
gtcctgctgagctgggccgtgacgcgcggcccctcgcccgatccgtccgcccgcaggctt
gcggtgcgaaccgaggatcatccgctggattatgccgagttcgagggcacgatccccaag
ggcgaatatggcggcggcacggtcatgctctgggaccggggcacttgggaaccgcagggc
gactttgcggaggggctgcgcaccggtcagctcaagatccgcctcgcgggcgagcggatg
cgcggccgctggacgctggtgcgcatgaaacccaggccgcgcgagaaggccgagaactgg
ctcctcatcaaggagcacgacacgcatgaaagcgagcagaccgaggagctggtcgagcgg
cacatgacctcggtcgcaacggggcggaccatggagcagatcgccgccggcaaggcgcca
ccgcggcgcacgcgccaggctgccctgcccgccttccggccgctccagctcgcgcgcctc
gtttcggcggcgcccgagggcgaggactggatccacgagaccaagttcgacggctaccgc
tgcctcgcggccctcgccggaggtcgggcccgcctctacacccgctccggcctcgactgg
acggccaagttcggcgccctcgtcgaggatgtcgaggcgcttgaggcccaggaggcgctg
atcgacggcgaggtgatcgcgccgggccgggagggcggctcgttctccgagctgcaggca
cggctgaaatcggggggccagctcctcttcatgaccttcgacctgctgctcctcgacggc
gaggacctgaccggacagccgcttctcgcgcggaaggagcggctcaagacgctgatcggc
aaggggcgcggcgcggtgcgcttctcgggccacatccgcggccacggccccgaggtgcac
gagcgcatatgcgcagcgggccttgaagggatcgtctcgaagcgggcctccgcgccctat
gcgggcagccggaacggcgactggctgaaggtgaaatgcgcgcaccggcaggaattcgtg
atctgcggctggaacgcctcggacaagccgggccgtcccttcgcctcgctggtgatgggc
agctacgaaaagagccgtctggtctaccgcggcagtgtcggcagcggcttcggcgccccc
ctgttccgcgagttgaagccgcttctggccgaacgggcgcaaagcgcctgccccttcgac
cgcacgccggccgaggccaagggggcgcactggctgaagcccgagctggtggccgaggtg
agcttcaccgaactgacggcggaggggcacatccggcacggggtcttcgccggcctgcgg
agcgacaaggacgcgcgggaggtgcggctcgaggagcccgcgcccgaaacgcccgcgccc
cggaagtcgggcgtgcggaagaaggggacgaagacggcccggccagacgccccctcaccc
gacgagcccgcccccgagcctgcccggaaaccccggacggcgcgcggggagaagaaggag
acgacgatggcccgacccgacgacctgcgcgtcgcaggcatccgcatcagccaccccgac
cggcggatctacgaccggcccgccgtcacgaagcgcgaggtggcggagcatgccgaggca
ctggcgccgcggatgctgcgcttcctgaaggatcgtcccgtctcgctcctgcgttgcccg
gaaggggcggcggcggagtgcttcttccagaagcaccgcacccgcggcatgcccgtcgcg
atgaagacggtgcccgtcgagacgaaatcggggcccgaggatttcatcaccctgcccgat
gtcgcggctctggtcggggccacgcagatggggacactcgaattccacatctggggctcg
cgcaaccgcagccttcagcgaccggaccggctggtgttcgatctcgaccccgacgagggt
ctcgacttcgcccatgtgcggaccgcggcggccgagctgcgcggtctgctcacggacctc
ggcctgccctcggtgccgatgctctccggcggcaagggggtgcatgtgatcgtgccgctg
aagcccaaggccgaatgggagagcgtgaagctcttctcgcgggcgctcgccacccatctg
gctcaggaggcgcccgaccgctacacggccacgatggccaaggccgggcgcaagggccgg
atcttcatcgactggctgcggaacgaccgcggctcgacggcgatcgctccctacagcctg
cgcgcccgcccgggcgcgccggtggcgacgccggtcgactgggacgaactcgcctcggcc
cggtcgggcggcgactggacgatccgctccatccgcgaccggctcgaccggccctgcccg
ctggccgaggcctccgcccggcccgcgacactgggtcggaccgtgatcgggcggctcgag
cgacttgtggcaggagggaaaccatga

DBGET integrated database retrieval system