KEGG   Rhodobacter sphaeroides 2.4.1: RSP_3176Help
Entry
RSP_3176          CDS       T00284                                 

Gene name
fabI
Definition
(RefSeq) Enoyl-(acyl-carrier-protein) reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
rsp  Rhodobacter sphaeroides 2.4.1
Pathway
rsp00061  Fatty acid biosynthesis
rsp00780  Biotin metabolism
rsp01100  Metabolic pathways
rsp01130  Biosynthesis of antibiotics
rsp01212  Fatty acid metabolism
Module
rsp_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:rsp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RSP_3176 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    RSP_3176 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    RSP_3176 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rsp01004]
    RSP_3176 (fabI)
Enzymes [BR:rsp01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     RSP_3176 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     RSP_3176 (fabI)
Lipid biosynthesis proteins [BR:rsp01004]
 Fatty acid synthase
  Component type
   RSP_3176 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-GeneID: 3721467
NCBI-ProteinID: YP_354692
UniProt: Q3IXE3
LinkDB All DBs
Position
2:complement(228732..229520)
Genome map
AA seq 262 aa AA seqDB search
MADLMKGKRGLVMGVANDRSIAWGIARALAAEGAELAFSYQGEAFGKRVEPLAASVGSDF
LVDVDVMDDASLDACFGALKDRWGTLDFVVHAIAYSDKTELAGRFINTSRENFRNSLTIS
CYSFIDIARRASELMPDGGALLTLTYQGSNRVTPYYNVMGVAKSALESAVRYLANDLGPQ
KIRVNAISPGPMKTLAGAAIAGARATFRHTEANAPLRANATLEAVGGTAAWLASDYGACT
TGEIVRVDGGYHVLGMPQPDHL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggccgatctgatgaagggtaaacgcggtctggtgatgggggtcgcgaacgaccgctcg
atcgcctggggcattgcacgcgccctggccgccgaaggggccgaactcgccttctcctat
cagggcgaggcgttcggcaagcgggtcgagccgctggcggcctcggtcggctcggacttc
ctcgtcgatgtcgatgtgatggacgatgcctcgctcgacgcctgcttcggcgcgctgaag
gatcgctggggcacgctcgacttcgtggtccatgcaatcgcctattcggacaagaccgaa
ctcgccggacgcttcatcaacacctcgcgcgagaacttccgcaattcgctgacgatctcg
tgctattccttcatcgacatcgcgcggcgcgcctcggagctcatgcccgacggcggcgcg
ctgctgacgctgacctatcaggggtcgaaccgggtgacgccctattacaacgtgatgggc
gtggcgaaatcggcgctggaatcggcggtgcggtatctcgccaatgacctcgggccgcag
aagatccgggtgaatgcgatttcgcccggcccgatgaagacgctcgcgggcgcggccatc
gcgggcgcgcgcgccaccttccgccacaccgaggccaacgcgcccctgcgggcgaacgcg
acgctcgaagcggtgggcggcacggcggcatggctcgcctcggactatggcgcctgcacc
acgggcgagatcgtccgggtggacggcggctatcatgtgctggggatgccgcagcccgac
catctctga

DBGET integrated database retrieval system