KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0077Help
Entry
Rsph17025_0077    CDS       T00512                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E1 component
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00020  Citrate cycle (TCA cycle)
rsq00310  Lysine degradation
rsq00380  Tryptophan metabolism
rsq01100  Metabolic pathways
rsq01110  Biosynthesis of secondary metabolites
rsq01120  Microbial metabolism in diverse environments
rsq01130  Biosynthesis of antibiotics
rsq01200  Carbon metabolism
Module
rsq_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rsq_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Rsph17025_0077
  09105 Amino acid metabolism
   00310 Lysine degradation
    Rsph17025_0077
   00380 Tryptophan metabolism
    Rsph17025_0077
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     Rsph17025_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transket_pyr E1_dh OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-ProteinID: ABP68988
UniProt: A4WNM4
LinkDB All DBs
Position
complement(84305..87268)
Genome map
AA seq 987 aa AA seqDB search
MTEQSPNAQFHASSFLQGQNAEYIDQLQARYAEDPASVDAGWAELFRSLGDSELDAKRQA
HGPSWARTDWPPTPADDLTAALTGEWPAAPPKEARTAGQKIAAKAAEKGVSLSDAQVQRA
VLDSIRALMIIRAYRIRGHLAADLDPLGMRNTSNHPELDPRSYGFTEADMDRPIFIDNVL
GLQVASMRQIVDMVKRTYCGTFALQYMHISDPEQAAWLKERIEGYGKEIHFTREGRRAIL
NKMVEAEGFEKFLHVKYMGTKRFGLDGGESLIPAMEQIIKRGGALGVKEIVIGMPHRGRL
SVLANVMAKPYRAIFNEFQGGSFKPEDVDGSGDVKYHLGASSDREFDGNTVHLSLTANPS
HLEAVNPVVLGKVRAKQEQAGDKTRHTVLPILLHGDAAFAGQGVVAECFGLSGLVGHRTG
GTIHIVVNNQIGFTTAPSFSRSSPYPTDIALMVEAPIFHVNGDDPEAVVHAAKVATEFRQ
KFHKDVVIDIFCYRRFGHNEGDEPMFTNPAMYTSIKKHKTTLQLYTERLVQDGLIPEGEI
EDMKAAFQARLNEEFEAGKDFKPNKADWLDGRWKHIDRHGDEYQPGRTSIAAETLQEIGQ
ALTRVPEGFDLHKTVGRQLEAKKQMFETGKGFDWATGEALAFGSFVVEGYPVRLSGQDCT
RGTFSQRHSAFINQSTEERYYPLNNIRSGQARYEVIDSMLSEYAVLGFEYGYSLAEPNAL
VMWEAQFGDFANGAQIMFDQFINSGESKWLRMSGLVVLLPHGFEGQGPEHSSARLERFLQ
MSANDNWIVANCSTPANYFHILRRQIHRNFRKPLILMTPKSLLRHPLCISNAEDFTTGSG
FHRVLWDDAQKGHSETVLKPDAEIRRVVICSGKVYYDLLAERDKRGIDDIYLLRLEQFYP
FPALSLVKELGRFKEADIVWCQEEPKNQGGWTFVEPNLEWVLTRIGARHHRAHYAGRAAS
ASPATGLASRHKAEQEALVNDALTIGS
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacagtctccgaacgcgcagttccacgcctcgagtttcctccaggggcagaat
gccgagtatattgaccagttgcaggcacgttatgccgaagatcccgcatcggtggatgca
ggctgggcggagttgttccgttcgctgggtgacagcgaactcgacgccaagcgtcaggcg
cacgggcccagctgggcgcgcacggactggcccccaacgccggccgacgatctgacggcc
gcgctcaccggcgaatggcccgcagccccgccgaaggaagcccgcaccgccggccagaag
atcgccgccaaggccgccgagaagggcgtaagcctgtccgacgcgcaggtgcaacgcgcc
gtcctcgactcgatccgggcgctgatgatcatccgggcctaccggatccgcggccatctg
gccgccgatctcgatccgctcgggatgcgcaacacctcgaaccaccccgaactcgacccc
aggtcctacggcttcaccgaagcggacatggaccggccgatcttcatcgacaatgtgctc
ggtcttcaggtcgcttcgatgcgacagatcgtggatatggtcaagcgcacctactgcggc
actttcgctctgcagtacatgcatatttcggatcccgagcaggcagcctggctcaaggag
cggatcgagggctacggcaaggagatccacttcacccgtgagggccgccgcgccatcctg
aacaagatggtcgaggccgagggcttcgagaagttcctccatgtgaaatacatgggcacc
aagcggttcggcctcgacggcggcgaaagcctgatccccgcgatggagcagatcatcaag
cgcggcggtgcgctgggtgtgaaggagatcgtgatcggcatgccgcaccgcggccgcctg
tcggtgctggccaacgtgatggccaagccctaccgcgccattttcaacgaattccagggc
ggcagcttcaagcccgaggatgtcgatggctccggcgacgtgaaataccacctcggcgcc
tcgtccgaccgcgagttcgacggcaacaccgtccacctgtcgctgaccgcgaaccccagc
cacctcgaggcggtgaacccggtcgtgctgggcaaggtccgcgccaagcaggagcaggcg
ggcgacaagacgcgccataccgtcctgccgatcctactgcatggcgacgcggcctttgcc
gggcaaggcgtggtggccgagtgcttcggcctgtcgggcctcgtcgggcatcgcaccggc
ggcacgatccatatcgtcgtgaacaaccagatcggcttcaccaccgcgccgtccttctcg
cgctcgtcgccctaccccaccgacatcgcgctgatggtcgaggcaccgattttccatgtg
aacggcgacgatcccgaggccgtggttcatgcggcgaaggtggcgaccgagttccggcag
aagttccacaaggatgtcgtcatcgacatcttctgctaccggcgcttcgggcacaacgag
ggcgacgagcccatgttcaccaacccggcgatgtacacctcgatcaagaagcacaagacg
acgctccagctctacaccgagcgtctggtgcaggacggcctcatccccgagggcgagatc
gaggacatgaaggccgcctttcaggcccggctcaacgaggaattcgaggccggcaaggac
ttcaagccgaacaaggccgactggctcgacggccgctggaagcacatcgaccggcatggc
gacgaataccagccgggccgcacctcgatcgcggccgagacgctgcaggagatcggtcag
gcgctgacgcgcgtgcccgaagggttcgacctgcacaagacggtcggccgccagctcgag
gccaagaagcagatgttcgagaccgggaagggcttcgactgggcgacgggcgaggcgctg
gccttcggttcgttcgtggttgaaggttacccggtgcgcctctcggggcaggactgcacc
cgcggcaccttcagccagcggcactcggccttcatcaaccagtcgaccgaggaacgctac
tacccgctgaacaacatccgttcgggtcaggcgcgctacgaggtcatcgactcgatgctg
tcggaatatgccgtgctcggcttcgagtatggctattcgctggccgagccgaatgcgctg
gtcatgtgggaggcccagttcggcgatttcgccaacggcgcccagatcatgttcgaccag
ttcatcaactcgggcgagtcgaagtggctgcgcatgtcgggccttgtggtgctgctgccg
cacggcttcgagggccagggccccgagcattcctcggcccggctcgagcgcttcctccag
atgtcggccaacgacaactggatcgtggcgaactgctcgaccccggcgaactacttccac
atcctgcgccggcagatccatcgcaacttccgcaagccgctgatcctgatgacgccgaaa
tcgcttctgcgccatccgctctgcatttcgaacgccgaggatttcaccaccggatcgggc
ttccaccgggtgctgtgggacgacgcgcagaagggccactccgagacggtcctgaagccc
gacgccgagatccggcgcgtggtgatctgctcgggcaaggtctattacgaccttctggcc
gagcgcgacaagcggggcatcgacgacatctacctcctgcggctcgagcagttctacccc
ttcccggcgctgagcctcgtgaaggagctgggccgcttcaaggaggccgacatcgtctgg
tgccaggaagagccgaagaaccagggcggctggacctttgtcgagccgaacctcgaatgg
gtgctgacgcggatcggtgccaggcaccaccgcgcccactatgccggccgagcggcctcg
gcttcgcccgccacgggcctggccagccgccacaaggcggaacaggaggcgctggtgaat
gacgcgctgacgatcgggagctga

DBGET integrated database retrieval system