KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0253Help
Entry
Rsph17025_0253    CDS       T00512                                 

Definition
(GenBank) Glutathione S-transferase, N-terminal domain
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Rsph17025_0253
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rsq02000]
    Rsph17025_0253
Enzymes [BR:rsq01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Rsph17025_0253
Transporters [BR:rsq02000]
 Other Transporters
  Pores ion channels [TC:1]
   Rsph17025_0253
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-ProteinID: ABP69163
UniProt: A4WP49
LinkDB All DBs
Position
246349..246966
Genome map
AA seq 205 aa AA seqDB search
MDKLTFYTNPRSRGRIARWMLEEIGQPYETVVLDYGAPMRSPAYLELNPMGKVPTVTHGP
RVITETAAICAYLADAFPEAGLLPANRASYYRWLFFAAGPFEAAVIDRALGLQIPPERTV
MVGYGDFDRTIATLEQAVSASPFIAGESFSAADVQVGLQIGWGLEFGTIPDRPAFRAYWK
RLKDRPALLRANALDDALARGSADA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggacaaactcacgttctacacgaacccgcgctcgcgggggcggatcgcgcgctggatg
ctcgaggagatcggccagccctacgagacggtggttctggactatggggcgccgatgcgc
agccccgcctatctcgagctgaacccgatggggaaggtcccgaccgtcacccacgggccg
cgcgtgatcaccgagaccgccgcgatctgcgcctatcttgccgacgccttccccgaagcg
ggcctgctgccggccaaccgcgcctcctactaccgctggctcttctttgccgcaggtccg
ttcgaggctgccgtcatcgaccgggcgctcggcctgcagatcccaccggagcggacggtc
atggtgggctatggagacttcgaccggaccatcgccaccctcgaacaggcggtatccgcc
tctccgttcattgcgggcgagagcttcagtgcggctgacgtgcaggtgggtttgcagatc
ggctgggggctcgagttcggaacgatcccggaccggccggccttccgcgcctactggaag
cggctgaaggatcgccccgccttgctgcgggccaacgcgcttgacgacgcactggcccga
gggtcggccgatgcctga

DBGET integrated database retrieval system