KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_0697Help
Entry
Rsph17025_0697    CDS       T00512                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00473  D-Alanine metabolism
rsq00550  Peptidoglycan biosynthesis
rsq01100  Metabolic pathways
rsq01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Rsph17025_0697
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Rsph17025_0697
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    Rsph17025_0697
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rsq01011]
    Rsph17025_0697
Enzymes [BR:rsq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Rsph17025_0697
Peptidoglycan biosynthesis and degradation proteins [BR:rsq01011]
 Precursor biosynthesis
  Amino acid ligase
   Rsph17025_0697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABP69603
UniProt: A4WQD9
LinkDB All DBs
Position
705056..705979
Genome map
AA seq 307 aa AA seqDB search
MAGRSGRTFPRVAVLMGGTSSEREVSLSSGHSCSAALRDAGYEVTEVDAGPDLARVLAEV
QPDAVFNALHGRWGEDGCVQGLLEWLRIPYTHSGVLASALAMDKARAKEVFAAAGLPVTQ
SVIATPDEVQAGHVLPPPYVVKPNCEGSSVGVYIVQADANGPPRLAPDMPRDLMVETYIP
GRELTVTVMGDRALAVTDIVTDGWYDYDAKYRPGGSRHVVPAELPAEITDACLDIALRAH
RALGCRGISRSDLRWDESRGAEGLILLETNTQPGMTPTSLSPEQAAHCGLSFPEFCAWMV
EDASCNR
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggcgggacggtccggcaggacgttccccagggttgctgtgctgatgggtgggacctcg
tccgagcgcgaggtgtcgctttcgtcgggtcattcgtgcagcgcggctctgagggacgca
ggctatgaggtgacggaggtcgatgccggccccgacctcgcccgcgtgcttgccgaagtg
cagcccgatgcggtcttcaacgcgctccacggccgctggggcgaggatggctgcgtgcag
ggcctgctcgagtggctccgcattccctacacccattccggcgtgctggcctcggcgctg
gcgatggacaaggcccgcgcgaaggaagtctttgccgcggccggcctgcccgtcacgcag
agcgtcatcgccacccccgacgaggtgcaggcaggccatgtcctgccgccgccctatgtg
gtcaagccgaactgcgaagggtcctcggtgggggtctatatcgtgcaggcggatgccaac
ggtccgccccgcctcgcgcccgacatgccgcgggatctgatggtcgagacctacattccg
ggacgcgagctgaccgtcaccgtgatgggcgaccgggcccttgcggtgaccgacatcgtg
accgacggctggtatgactacgacgccaagtatcgccccggcgggtcgcgccatgtcgtt
ccggccgagcttcccgcggaaatcacggacgcatgcctcgacatcgcgctgcgcgcccat
cgcgcgctcggctgccggggcatctcgcggtcggacctgcggtgggacgagtcgcgcggg
gccgaggggctgatcctgctcgagaccaacacccagccgggcatgacgcccacctcgctc
tcgcccgagcaggcggcccattgcggcctctccttccccgagttctgcgcctggatggtg
gaggacgcctcgtgcaatcgttga

DBGET integrated database retrieval system