KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2711Help
Entry
Rsph17025_2711    CDS       T00512                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00630  Glyoxylate and dicarboxylate metabolism
rsq00710  Carbon fixation in photosynthetic organisms
rsq01100  Metabolic pathways
rsq01120  Microbial metabolism in diverse environments
rsq01200  Carbon metabolism
Module
rsq_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rsq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rsq_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rsph17025_2711
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17025_2711
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rsph17025_2711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ABP71598
UniProt: A4WW34
LinkDB All DBs
Position
complement(2747731..2748120)
Genome map
AA seq 129 aa AA seqDB search
MRITQGCFSFLPDLTDEQISAQVEYCLSRGWAVSLEYTDAPHPRNTYWEMWGMPMFDLRD
PKGVMMELEECRKAFPDHYIRINAFDSTRGFETVTMSFIVNRPKVEPTIRMDRTEVDGRS
IRYTHGIVR
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattacccagggctgcttttcgttcctgccggacctgacggacgagcagatctcg
gcgcaggtggaatattgcctgtcgcgcggctgggccgtgagtctggaatacaccgacgcg
ccccatccccggaacacctactgggagatgtgggggatgccgatgttcgacctgcgcgac
cccaagggcgtgatgatggagctggaggaatgccgcaaggccttcccggaccactacatc
cgcatcaacgccttcgactccacccgcggcttcgagaccgtgacgatgagcttcatcgtc
aaccgcccgaaggtcgagccgaccatccgcatggaccgcaccgaggtggacggccggtcc
atccgctatacgcacggcatcgtccgctga

DBGET integrated database retrieval system