KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_2712Help
Entry
Rsph17025_2712    CDS       T00512                                 

Definition
(GenBank) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00630  Glyoxylate and dicarboxylate metabolism
rsq00710  Carbon fixation in photosynthetic organisms
rsq01100  Metabolic pathways
rsq01120  Microbial metabolism in diverse environments
rsq01200  Carbon metabolism
Module
rsq_M00165  Reductive pentose phosphate cycle (Calvin cycle)
rsq_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
rsq_M00612  Anoxygenic photosynthesis in purple bacteria
Brite
KEGG Orthology (KO) [BR:rsq00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Rsph17025_2712
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Rsph17025_2712
Enzymes [BR:rsq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     Rsph17025_2712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: ABP71599
UniProt: A4WW35
LinkDB All DBs
Structure
PDB: 

Position
complement(2748132..2749592)
Genome map
AA seq 486 aa AA seqDB search
MDTKNTEIKGKERYKAGVLKYAQMGYWDGDYQPKDTDVLALFRITPQEGVDPIEAAAAVA
GESSTATWTVVWTDRLTACDSYRAKAYKVEPVPGTPGQYFCYVAYDLILFEEGSIANLTA
SIIGNVFSFKPLKAARLEDMRFPVAYVKTYKGPPTGIIVERERLDKFGKPLLGATTKPKL
GLSGKNYGRVVYEGLKGGLDFMKDDENINSQPFMHWRDRFLYVMEAVNLASAQTGEVKGH
YLNITAGTMEEMYRRAEFAKSLGSVIVMVDLIIGYTAIQSISEWCRQNDMILHMHRAGHG
TYTRQKNHGISFRVIAKWLRLAGVDHLHCGTAVGKLEGDPPTVQGYYNVCREPFNTVDLQ
RGLFFEQDWADLKKVMPVASGGIHAGQMHQLLSLFGDDVVLQFGGGTIGHPMGIQAGATA
NRVALEAMVLARNEGRNIDVEGPEILRAAAKWCKPLEAALDTWGNITFNYTSTDTSDFVP
TPSVSM
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaagaacaccgagatcaagggcaaggaacgctacaaggcgggcgtcctgaaa
tatgcccagatgggctattgggacggggactatcagcccaaggacaccgacgtgctggcg
ctgttccgcatcacgccgcaggagggggtggacccgatcgaggccgcggccgcggtggcg
ggcgaaagctcgaccgcgacctggaccgtggtctggaccgaccggctgaccgcctgcgac
agctaccgcgccaaggcctacaaggtcgaacccgtgcccggaacgccggggcagtatttc
tgctacgtcgcctacgacctgatcctgttcgaggaaggctcgatcgccaacctgacggct
tcgatcatcggcaacgtcttcagcttcaagccgctcaaggccgcgcggctcgaggacatg
cgcttccccgtcgcctatgtgaagacctacaagggtccgccgaccggcatcatcgtggaa
cgtgagcggctggacaagttcggcaagcccttgctcggcgccacgacgaagccgaagctc
ggcctgtcgggcaagaactacggccgcgtggtctatgaggggctgaagggtggcctcgac
ttcatgaaggacgacgagaacatcaactcgcagcccttcatgcattggcgcgaccgcttc
ctctatgtgatggaggcggtaaacctcgcctcggcccagaccggcgaggtgaagggccac
tacctcaacatcaccgccggcacgatggaggaaatgtaccgccgggccgagttcgccaag
tcgctgggctcggtcatcgtgatggtggacctgatcatcggctataccgcgatccagtcg
atctcggagtggtgccggcagaacgacatgatcctgcacatgcaccgcgcgggccacggc
acctacacccggcagaagaaccacgggatcagcttccgcgtgatcgccaagtggctgcgg
ctggcgggcgtggaccacctgcattgcggcaccgccgtcggcaagctggagggcgatccg
ccgaccgttcagggctactacaacgtctgccgcgagccgttcaacacggtggacctgcag
cgcggcctcttcttcgagcaggactgggcggatctgaagaaggtcatgccggtcgcctcg
ggcggcatccacgcggggcagatgcaccagctgctgagcctcttcggggatgacgtggtg
ctgcagttcggcggcggcaccatcggccacccgatgggcatccaggccggcgcgacggcg
aaccgcgtggcgctggaggcgatggtcctggcccgcaacgagggccgcaacatcgacgtg
gaaggccccgagatcctgcgcgccgccgccaaatggtgcaagccgctggaggccgccctc
gatacctggggcaacatcaccttcaactacacctccaccgacacgtcggacttcgtgccg
accccctcggtctcgatgtaa

DBGET integrated database retrieval system