KEGG   Rhodobacter sphaeroides ATCC 17025: Rsph17025_3580Help
Entry
Rsph17025_3580    CDS       T00512                                 

Definition
(GenBank) hypothetical protein
  KO
K05351  D-xylulose reductase [EC:1.1.1.9]
Organism
rsq  Rhodobacter sphaeroides ATCC 17025
Pathway
rsq00040  Pentose and glucuronate interconversions
rsq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rsq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Rsph17025_3580
Enzymes [BR:rsq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.9  D-xylulose reductase
     Rsph17025_3580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABP72449
UniProt: A4WYI5
LinkDB All DBs
Position
pRSPA01:complement(469623..470675)
Genome map
AA seq 350 aa AA seqDB search
MKSLVLERKDELSLRDFPDIDRQEEVLGPRDVRIKLHTVGICGSDVHYYTHGRIGPFVVN
EPMVLGHEASGTVIEVGAQVTTLKVGDRVCMEPGIPDPNSKAARMGMYNIDPAVRFWATP
PIHGILRPTCVHPEAFTYRLPDNVSFAEAAMVEPLAVGVHAATKARIRPGDIGLVMGAGP
IGLVTALSALAGGCARVYVTDLAPKKLEIAESLSPAITGVNVASDDIVARIKAETDGWGA
DVVFEATGSPKAAAGVFEPLAPGGCVVMIGGQPDPISYDAGAAMVREARVENIFRYAHVF
PRCVAMLASGAIDVKPLITRTFAFEDSVHAFEVAASAPPADVKMQIELPQ
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcgctcgtcctcgaacggaaagacgaactgtcgctgcgcgacttccccgacatc
gaccggcaggaggaggtgcttgggccccgcgatgtgcgcatcaagctgcacaccgtgggc
atctgcggatcggacgtgcattactacacccacggccggatcggccccttcgtggtgaac
gagccgatggtcctcggccacgaagcctcgggcacggtgatcgaggtgggcgcgcaggtc
acgacgctcaaggtcggcgaccgcgtctgcatggagccgggcattcccgacccgaactcg
aaggccgcacggatggggatgtacaacatcgaccccgcggtgcgcttctgggccacgccg
ccgatccacggcatcctgcgcccgacctgcgtccacccggaagccttcacctatcggctg
ccggacaatgtcagcttcgccgaggccgcgatggtcgagccgctggccgtgggcgtccat
gccgccaccaaggcccgcatccgccccggcgacatcggccttgtcatgggggcgggcccc
atcggcctcgtcacggcactttccgccctcgcaggcggctgcgcgcgggtctatgtcacc
gacctcgcgccgaagaagctcgagatcgccgaaagcctcagccccgccatcaccggcgtc
aatgtcgccagcgacgacatcgtggcccgcatcaaggccgagaccgacggctggggcgcg
gatgtggtgttcgaggccaccggctcgcccaaggctgcggccggtgtcttcgagccgctc
gccccgggcggctgcgtggtgatgatcggcggccagcccgacccgatctcctacgacgcg
ggcgcggccatggtgcgcgaggcgcgggtcgagaacattttccgctacgcccatgtcttt
ccgcgctgcgtggcgatgctggccagcggcgccatcgacgtcaagccgctcatcacccgc
accttcgccttcgaggacagcgtccatgccttcgaagtggcagcctcggcgccgcccgcc
gacgtgaagatgcagatcgagctgccgcagtag

DBGET integrated database retrieval system