KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109434612Help
Entry
109434612         CDS       T04863                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X1
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04371  Apelin signaling pathway
rss05034  Alcoholism
rss05165  Human papillomavirus infection
rss05169  Epstein-Barr virus infection
rss05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    109434612 (HDAC4)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    109434612 (HDAC4)
  09164 Substance dependence
   05034 Alcoholism
    109434612 (HDAC4)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    109434612 (HDAC4)
   05165 Human papillomavirus infection
    109434612 (HDAC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rss03036]
    109434612 (HDAC4)
Enzymes [BR:rss01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     109434612 (HDAC4)
Chromosome and associated proteins [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     109434612 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 109434612
NCBI-ProteinID: XP_019567263
LinkDB All DBs
Position
Unknown
AA seq 1083 aa AA seqDB search
MSSQSHPDGLSGRDQPVELLNPTRVNHMPSTVEVASALPLQVAPPAVPMDLRLDHQFPLP
VAEPALREQQLQQELLALKQKQQLQRQLLIAEFQRQHEQLSRQHEAQLHEHIKHQQELLA
MKHQQELLEHQRKLERHRQEQELEKQHREQKLQQLKNKEKGKESAVASTEVKMKLQEFVL
NKKKALAHRGLNHCLSSDPRYWYGKTQHSSLDQSSPPQSGVSASYNHPVLGMYDAKDDFP
LRKTASEPNLKLRSRLKQKVAERRSSPLLRRKDGPVVTALKKRPLDVADSACSSAPGSAP
SSPNNSSGSISAENGIAPAMPSLPAEASLAHRLVAREGSMAPLPLYTSPSLPNITLGLPA
TGPSAGAASQQDAERLALPSLQQRISLFPGSHLAPYLSTAPLERDGGTAHSPLLQHVVLL
EQPPAQTPLVTGLGALPLHAQPLVGADRLSPSVHKLRQHRPLGRTQSAPLPQSAQALQQL
VVQQQHQQFLEKHKQQFQQQQLHMGKMIPKPSEPARQPESHPEETEEELREHQALLEEPF
LDRLSAQKEAHAPGVQVKQEPAESDSEEAEPLREAEPGQRQPTEQELLFRQQALLLEQQR
IHQLRNYQASMEAAGIPVSFGGHRPLSRAQSSPASATFPMSVQEPPSKPRFTTGLVYDTL
MLKHQCTCGNTNSHPEHAGRIQSIWSRLQETGLRGKCECIRGRKATLEELQTVHSEAHTL
LYGTNPLNRQKLDSKKLLGSLTSVFVRLPCGGVGVDSDTIWNEVHSSGAARLAVGCVVEL
VFKVATGELKNGFAVVRPPGHHAEESTPMGFCYFNSVAIAAKLLQQRLNVSKTLIVDWDV
HHGNGTQQAFYSDPSILYISLHRYDDGNFFPGSGAPDEVGTGPGVGFNVNMAFTGGLDPP
MGDAEYLAAFRMVVMPIANEFGPDVVLVSSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLM
GLAGGRIVLALEGGHDLTAICDASEACVSALLGDELDPLPEKVLQQRPNANAVRSVEKVI
EIHSQYWRSLQRLSPTAAYSLVEAQKCENEEAETVTAMASLSVGVKPAEKRPEEEPMEEE
PPL
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atgagctcccaaagccacccagatggcctttctggccgagaccagcccgtggagctgctg
aaccccacccgcgtgaaccacatgcccagcacggtggaggtggcctcggcgctgcccttg
caggtggccccaccggcagtgcccatggacctgcgcctggaccaccagttcccgctgccc
gtggccgagcccgccctgcgcgagcagcagctgcagcaggagctcctggcgctgaagcag
aagcagcagctgcagaggcagctcctcatcgccgagttccagcggcagcacgagcagctg
tcacggcagcacgaggcccagctgcatgagcacatcaagcaccagcaggagctgctggcc
atgaagcaccagcaggagctgctggagcatcagcggaagctggagcgacaccgccaggag
caggagctggagaagcagcaccgggagcagaagctgcagcagctcaagaacaaggagaaa
ggcaaagagagtgccgtggccagcacggaggtgaagatgaagctgcaggagtttgtgctg
aacaaaaagaaggcgctggcgcaccggggcctgaaccactgcctctccagcgacccccgc
tactggtacgggaaaacacagcacagctccctggaccagagctcaccgccccagagcggg
gtgtcggcctcctacaaccacccggtcctgggcatgtacgacgccaaagatgacttccct
ctcagaaagacagcttctgaacccaacctgaaattacggtcgcggctaaagcagaaagtg
gctgagagacggagcagccccctgctgcgcaggaaagacgggccggtggtcaccgctctg
aaaaagcgtccactggatgtcgcagactcggcctgcagcagcgcccccggctctgccccc
agctcgcccaacaacagctccgggagcatcagcgccgaaaacgggatcgcgccagccatg
cccagcctcccggccgaggccagcttggcgcaccgactggtggcccgggaaggctccatg
gccccgctccccctctacacctcgccgtccttgcccaacatcacgctggggctccccgcc
accggcccttctgcgggggcggccagccagcaggacgccgagagactcgccctccccagc
ctccagcagcgcatctccctgtttcccggctcccacctggccccctacctgagcacggcg
cccctggagcgggacggcgggacggcccacagccctttgctgcagcacgtggtcttgttg
gagcagccgcccgcacagacgccccttgtcacaggcctcggggctctgcccctgcacgca
cagcccctggtgggcgcagaccggctgtcgccgtcggtgcacaagctgcggcagcaccgc
ccgctggggcgaacgcagtccgcgccgctgccccagagcgcgcaggccctgcagcagctg
gtggtccagcagcagcaccagcagttcctggagaagcacaagcagcagttccagcagcag
cagctacacatgggcaagatgatccccaagcccagcgagcccgctcggcagcccgagagc
caccccgaggagacggaggaggagctccgcgagcaccaggcgctcctggaagagcccttc
ctggatcggctgtcggcgcagaaggaggctcatgcgccaggcgtgcaggtgaagcaagag
cccgcggagagtgacagcgaggaggcggagccactgcgggaggcggagcctggccagcgc
cagcccaccgagcaggagctgctcttcagacagcaagcgcttctcctggaacagcagcgg
atccaccagctgaggaactaccaggcctccatggaggccgctggcatcccagtgtccttt
ggcggccaccgacctctgtcccgggcacagtcctcccccgcctcggccaccttccccatg
tctgtgcaggagccacccagcaaaccgaggttcaccacaggcctggtgtacgacacgctc
atgctgaagcaccagtgcacgtgtgggaacaccaacagccacccggagcacgccggcagg
atccagagcatctggtcccggctgcaggagaccggcctgcggggcaaatgcgagtgcatc
cgcggacggaaggccaccctggaggagctgcagaccgtgcattcggaggcacacaccctg
ctctacggcacgaaccccctcaacaggcagaaactggacagtaagaaacttctaggctcg
ctaacgtccgtgtttgtcaggctgccctgtggtggtgtcggggttgacagtgacaccata
tggaacgaggtgcactcgtcgggggcggcccgcctggccgtgggctgcgtggtggagctt
gtcttcaaggtcgccacaggagagctgaagaatggctttgccgtggtccgccctcccggc
catcacgcggaggagagcacgcccatgggcttctgctacttcaattctgtggccatcgcc
gccaagctcctccagcagaggctgaacgtgagcaagacgctgatcgtggactgggacgtg
caccatgggaacgggacccagcaggccttctacagtgacccaagtatcctgtacatctca
ctgcaccgctacgatgacggcaacttcttcccaggcagcggggcacctgacgaggtgggc
acagggccgggcgtgggtttcaacgtgaacatggctttcaccggtggcctcgaccccccc
atgggagacgccgagtacttggcagcctttagaatggtcgtcatgccgattgcaaatgag
tttggcccggatgtggtactggtatcgtcaggcttcgacgccgtggagggccaccccacg
cctctgggcggctacaacctctccgccaaatgtttcgggtacctgacgaagcagctgatg
ggcttggcaggcggccgtattgttctagccctggagggcggccatgacctcacggccatt
tgcgacgcctcggaagcatgtgtttctgctttgctgggagacgagcttgatcctctccca
gaaaaggttttacagcagagacccaatgctaacgctgtccggtccgtggagaaggtcatt
gaaatccacagtcagtactggcgctccctgcagcgcctgtcccccacggcggcctactcg
ctggtcgaggcccagaagtgcgagaacgaagaggctgagaccgtcacggccatggcctca
ctgtccgtgggtgtgaagccggccgagaagagacccgaggaggagccgatggaggaggag
ccgcccctgtag

DBGET integrated database retrieval system