KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109436894Help
Entry
109436894         CDS       T04863                                 

Gene name
WBSCR17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00512  Mucin type O-glycan biosynthesis
rss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109436894 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rss01003]
    109436894 (WBSCR17)
Enzymes [BR:rss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109436894 (WBSCR17)
Glycosyltransferases [BR:rss01003]
 O-Glycan biosynthesis
  Mucin-type
   109436894 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 109436894
NCBI-ProteinID: XP_019571332
LinkDB All DBs
Position
Unknown
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDTFHEIRPRAEAANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTRCKELKYNKELPQISIIFIFVNEALSVILRSVHSAVNHTP
TQLLKEIILVDDNSDEEELKAPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDTFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPMENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgttgctggtgttgaacttgatcgcggtggccggc
tttgtgctctttctggccaagtgccggcccatcgcggtgcgcagcggagacaccttccac
gagattcgaccgcgcgccgaggcggccaacctcagcgcgcacagcgccagccccatacag
gatgcggtcctgaagcgcctctcgctgctggaggacatcgtctaccggcaactgaatggc
ttatccaaatcccttgggctcattgaaggttatggtgggcggggcaaagggggccttcct
gctaccctttccccagctgaagaagaaaaagccaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatctcactggatcgttccattccggactaccgtcccacc
aggtgtaaggagctcaagtacaacaaggagctgccccagatatccatcatcttcatcttt
gtgaacgaggccctgtcggtgatcctgcggtcggtccacagtgctgtcaaccacacgccg
acacagctgctgaaggaaatcatcctggtggacgacaacagtgatgaagaggagctgaag
gcccccttggaggagtacgtccacaaacgctacccggggctggtgaaggtggtacgcaat
caaaaaagagagggcctcatcagagcgcgcatcgagggatggaaggtggccaccggccag
gtcaccggcttctttgatgcccatgtggaattcaccgctggctgggccgagcccgttcta
tcccgaatccaggagaaccggaagcgagtgatcctcccgtctattgacaacatcaaacag
gacacttttgaggtgcagcggtatgagaactcagcccacgggtacagctgggagctgtgg
tgcatgtacatcagcccccctaaggactggtgggacgccggagacccttctctccccata
aggacgccagccatgattggctgctccttcgtggtcaacaggaagttctttggtgaaatt
ggccttctggaccctgggatggatgtgtatggaggagaaaatatcgaacttggaatcaag
gtgtggctctgcgggggcagcatggaggtcctgccttgctcacgggtggcccacatcgag
cggaagaagaagccgtacaacagcaacatcggcttctacaccaagaggaatgctctgcgg
gtggctgaggtctggatggacgactacaagtctcacgtgtacatagcgtggaacctgccc
ctggagaatccaggaattgacataggtgatgtctctgaaagaagagccttaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggatcatgtttacccagaaatgagaagatac
aataacaccgttgcatatggggagcttcgcaacaacaaggcaaaagatgtctgcttggac
caggggccgatggagaaccacacagcaatcttgtacccatgccatggctggggaccccag
ctcgcccgatacaccaaggaaggctttctgcacttgggagccctggggaccactacgctc
ctccccgacacccgctgcctggtggacaactccaagagtcggttgccccagctccttgac
tgtgacaaggtcaagagcagcctatacaagcgctggaacttcatccagaatggagccatc
atgaataagggcactggccgctgcctggaagtggagaaccgtggcctggcgggcattgac
ctcatcctccgcagctgcacggggcagaggtggacgattaagaactccatcaagtag

DBGET integrated database retrieval system