KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109437164Help
Entry
109437164         CDS       T04863                                 

Gene name
TMPRSS4
Definition
(RefSeq) transmembrane protease serine 4
  KO
K09635  transmembrane protease serine 4 [EC:3.4.21.-]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rss00001]
 09160 Human Diseases
  09167 Infectious diseases
   05164 Influenza A
    109437164 (TMPRSS4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rss01002]
    109437164 (TMPRSS4)
Enzymes [BR:rss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     109437164 (TMPRSS4)
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109437164 (TMPRSS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 Trypsin_2 Ldl_recept_a SRCR
Motif
Other DBs
NCBI-GeneID: 109437164
NCBI-ProteinID: XP_019571743
LinkDB All DBs
Position
Unknown
AA seq 435 aa AA seqDB search
MDPDSDQPLNSLDVTPLRKPHTPLETFKKVGIPIIAALLSLATIVIVAVLIKVILDKHYF
LCGQPLHFISRSQVCDGQQDCASGEDEQHCVQNSPDGPPVAVRLSRDRSTLQVLDPVTRN
WASACFDNFTEALAQTACGQMGFYSKPTFKAVKIGPDQDLDVVEITANSQELQVRNPSGP
CLSGTLVSLHCLTCGESLKAPRVVGGQKAFVDSWPWQVSIQYNKQHICGGSILDPHWILT
AAHCFRKYLDVSNWKVRAGSDKLGNFLSMPVAKIFVAALNTTYPKEKDIALVKLQYPLTF
SDTVRPICLPFSDEELTPATPLWVIGWGFTEQGGGKMSDTLLQASVQVIDRTQCNAEDAY
QGEVTKEMLCAGILGGGVDTCQGDSGGPLMYHSDLWQVVGIVSWGHGCGGPSTPGVYTKV
TAYLNWIYNVRKSEP
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgacagtgatcaacccctgaacagccttgatgtcacccccctgcgcaaaccc
cacactcccctggagaccttcaaaaaggtggggatccccatcatcgcagcactgctgagc
ctggcaaccattgtcatcgtggctgtcctcatcaaggtgatcctggacaaacactacttc
ctctgcgggcagcctctgcacttcatctccaggagtcaggtgtgtgatggccagcaggac
tgtgcctcgggggaggacgagcagcactgcgtccagaactcccctgatgggcctccagtg
gcagtccgcctctccagagaccgatctacccttcaggtgctggacccggtcacaagaaac
tgggcctccgcctgttttgacaacttcacagaagctctggcccagacagcctgcgggcag
atgggcttttacagcaaacccaccttcaaagctgtgaagattggcccagaccaagatctg
gatgttgttgaaatcacagcaaatagccaggagcttcaggtgcgaaacccaagtggaccc
tgtctctcaggcaccctggtttccttgcactgccttacctgtggggagagcctgaaggcc
cctcgggtggtgggagggcagaaggcctttgtagattcttggccttggcaagtcagtatc
cagtacaacaaacaacacatctgtggagggagcatcctggacccccactggatcctcaca
gcagctcactgcttcaggaaatatctagatgtgtccaactggaaagtaagggccggctca
gacaaattgggcaacttcctgtccatgcctgtggccaagatctttgtcgctgcactcaac
accacgtaccccaaagagaaagacattgctctcgtgaagctgcagtacccactcacattc
tcagacacagtcaggcccatctgcctgcccttctctgatgaggagctcactccagccacc
ccactatgggtcatcggatggggctttacagaacagggtggagggaagatgtctgataca
ctgctgcaggcatcagtccaggtcattgacagaactcaatgcaatgcagaggatgcatac
cagggggaagttaccaaggagatgctgtgtgcaggcatcctggggggcggcgtggacacc
tgccagggtgacagcggcgggcccctgatgtatcactctgacctgtggcaagtagtgggc
atcgtgagctggggccatggctgtgggggcccgagtaccccaggagtatacaccaaggtc
acagcctatctcaactggatctacaatgtccggaagtctgagccatga

DBGET integrated database retrieval system