KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109437831Help
Entry
109437831         CDS       T04863                                 

Gene name
PYCARD
Definition
(RefSeq) apoptosis-associated speck-like protein containing a CARD
  KO
K12799  apoptosis-associated speck-like protein containing a CARD
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04217  Necroptosis
rss04621  NOD-like receptor signaling pathway
rss04623  Cytosolic DNA-sensing pathway
rss04625  C-type lectin receptor signaling pathway
rss05132  Salmonella infection
rss05133  Pertussis
rss05134  Legionellosis
rss05135  Yersinia infection
rss05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rss00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109437831 (PYCARD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    109437831 (PYCARD)
   04623 Cytosolic DNA-sensing pathway
    109437831 (PYCARD)
   04625 C-type lectin receptor signaling pathway
    109437831 (PYCARD)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    109437831 (PYCARD)
   05135 Yersinia infection
    109437831 (PYCARD)
   05133 Pertussis
    109437831 (PYCARD)
   05134 Legionellosis
    109437831 (PYCARD)
  09172 Infectious disease: viral
   05164 Influenza A
    109437831 (PYCARD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CARD PYRIN Tecti-min-caps
Motif
Other DBs
NCBI-GeneID: 109437831
NCBI-ProteinID: XP_019572858
LinkDB All DBs
Position
Unknown
AA seq 195 aa AA seqDB search
MGRARDAILEALENLTADEFKKFKMKLLSVPLREGYGRIPRGTLLPLDAMDLTDKLVSCY
LEGYSAELTAVLLRDIGMKELALQLQEVTGQGPGAAPAGIPTPRQAASMPALHFVDQHRA
ALIARVTDVDGVLDALYRRVLTEEQYQAVRAEPTNPTKMRKLFSFAPAWNVACKDMLLQA
LRDTQPYLVADLERS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcgcgcgcgacgccatcctggaggcgctggagaacctgaccgccgatgagttc
aagaagttcaagatgaagctgctttcggtgccgctgcgcgaaggctacggccgcatccct
cgggggacgctgctgcccctggacgccatggacctcaccgacaagctcgtcagctgctac
ctggaggggtacagcgccgagctcacggcggtcttgctgcgggacataggcatgaaggag
ctggccctgcagctgcaggaggtcacaggccagggccctggagccgcaccagccgggatc
ccgacccctcgccaggcggcaagcatgccagcactgcactttgtggaccagcaccgggct
gccctcatcgcacgggtcaccgacgtggacggggtgctggatgccctgtacaggagggtg
ctgacagaggagcagtaccaggccgtgcgcgctgagcccaccaaccccaccaagatgagg
aagctcttcagcttcgcccccgcctggaacgtggcctgcaaggacatgctccttcaggcc
ctgagggacacccagccctacctggtggccgacctggagaggagctga

DBGET integrated database retrieval system