KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109439428Help
Entry
109439428         CDS       T04863                                 

Definition
(RefSeq) anionic trypsin
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04080  Neuroactive ligand-receptor interaction
rss04972  Pancreatic secretion
rss04974  Protein digestion and absorption
rss05164  Influenza A
Brite
KEGG Orthology (KO) [BR:rss00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    109439428
 09150 Organismal Systems
  09154 Digestive system
   04972 Pancreatic secretion
    109439428
   04974 Protein digestion and absorption
    109439428
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05164 Influenza A
    109439428
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rss01002]
    109439428
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rss04147]
    109439428
Enzymes [BR:rss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     109439428
Peptidases [BR:rss01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   109439428
Exosome [BR:rss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109439428
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 109439428
NCBI-ProteinID: XP_019575289
LinkDB All DBs
Position
Unknown
AA seq 247 aa AA seqDB search
MNPLLFLAFVGVAVAFPADDDDKIVGGYTCRENSVPYQVSLNAGYHFCGGSLINDQWVVS
AAHCYKSRIQVRLGEHNIEVLEGNEQFINSAKVIRHPRFNSWTLDNDIMLIKLSSPAVIS
ARVSTISLPTACAPAGTQCLISGWGNTLSSGYNYPELLQCLDAPLLSQDQCEEAYPGQIT
KNMVCAGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAQKNNPGVYTRVCNFVDWIQ
ETIAANN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaatccactcctgttcctggcctttgtgggagtcgctgttgctttccccgctgacgac
gatgacaagatcgtcggaggctacacctgccgggagaactccgtcccctaccaggtgtcc
ctgaacgctggctaccacttctgtggtggctccctcatcaatgaccagtgggtggtgtct
gcagctcactgctacaagtcccgcatccaggtgaggctgggagaacacaacatcgaggtc
ttggagggcaatgaacagttcatcaactctgccaaggtcatccgccacccccgcttcaac
agctggacgctggacaatgacatcatgctgatcaagctctcctcgcctgcggtcatcagt
gcccgcgtgtccaccatctccctgcccacagcctgcgcacccgctggcacccagtgcctc
atctccggctggggcaacaccctgagctcaggctacaactaccccgagctgctgcagtgc
ctggatgcccctctgctgagccaggaccagtgtgaagaggcataccccggacagatcacc
aaaaacatggtctgtgctggcttcctcgagggaggcaaggactcctgccagggtgactct
ggtggccccgtggtctgcaatggagagctccagggagtcgtctcctggggctatggctgc
gcccagaagaacaatcctggtgtctacaccagggtctgcaactttgtggactggattcag
gagaccatagctgccaacaactaa

DBGET integrated database retrieval system