KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109440053Help
Entry
109440053         CDS       T04863                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00620  Pyruvate metabolism
rss01100  Metabolic pathways
rss01200  Carbon metabolism
Module
rss_M00168  CAM (Crassulacean acid metabolism), dark
rss_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    109440053
Enzymes [BR:rss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     109440053
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 109440053
NCBI-ProteinID: XP_019575776
LinkDB All DBs
Position
Unknown
AA seq 967 aa AA seqDB search
MPNRKLEKMASIDVHLRQLVPGKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL
YEHSAEYEGKHEPKKLEELGSVLTSLDPGDSIVIAKAFSHMLNLTNLAEEVQIAYRRRIK
KLKKGDFADESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAATMYFNQIEDLMFELSMWRCNDELRVRADELHVNRRKDAAKHYIEFWKS
IPPTEPYRVILGDVRDKLYHTRERARQLLSNGTSDVPEEATFNNLEEFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITKHLDIGSYREWSEE
RRQEWLLSELSGKRPLFGPDLPKTEEIADVLDTFHVIAELPSDSFGAYIISMATAPSDVL
AVELLQRECHVKRPLRVVPLFEKLADLEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
NGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPVSPKPEWRALLDEMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGAAIRHVIEKDVKNLHMLQDMYKHWPFFRVTIDLIEMVFAKGDPGIAALY
DKLLVSEELWPFGEKLRANFEETKKLILQTAGHKDLLEEDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPSYHVTLRPHISKEIAESSKSAQELVELNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatcggaagttagagaagatggcatcaattgatgttcatcttcgtcaattggta
cctggcaaagttagcgaagacgacaaacttattgagtatgatgctttgctcctggatcga
ttcctcgatatccttcaggatttgcacggcgaggatcttcgagaaactgttcaagagctt
tatgagcattctgcagagtacgaagggaagcatgagccaaagaagctagaggagctaggg
agtgttcttacgagcttagatccaggagactccattgtcatcgctaaagccttctctcac
atgcttaacttaaccaatctggctgaggaagtgcagattgcttatcgccgtaggatcaag
aagctgaagaaaggtgatttcgctgatgagagctctgctactactgaatctgacctcgaa
gaaactttcaaaaagcttgttggtgatctgaacaagtctcctgaagagatctttgatgct
ctcaagaatcagactgtcgatttggttttgactgctcatcctactcagtctgtgagaaga
tcattgcttcagaaacatgggaggataagagactgtctggctcaactatatgctaaggat
attactcctgatgacaagcaagagctcgacgaggctcttcagagagagattcaagctgca
ttccgaacagatgaaatcaaaagaacaccaccgacacctcaagatgagatgagagctggg
atgagttatttccatgaaactatctggaaaggtgttcctaagtttctacgccgtgtagat
acggctctgaaaaacatagggatcgaagagcgtgttccatataatgctccgctgattcag
ttttcttcttggatgggtggtgatcgtgatggtaatccaagggttacacctgaagtcact
agagatgtgtgcttgttggctagaatgatggctgctactatgtacttcaaccaaatcgaa
gaccttatgtttgagttgtctatgtggcgttgcaatgacgagctgcgtgtgcgagctgat
gaacttcacgtaaataggaggaaagacgctgcaaaacattacatagagttttggaagtca
attcctccaaccgaaccataccgtgtgattcttggtgatgtaagggacaaactttatcac
acacgtgaacgcgctcgccaattgctcagcaatggaacctctgatgttcctgaagaagct
actttcaacaacttggaagagttcttggaaccgcttgagctttgttaccgatcactgtgt
tcatgtggtgaccgtccaatcgctgatggaagccttcttgatttcttgaggcaagtctca
acctttggactctctcttgtgaggcttgacataaggcaagaatctgaccgccacaccgat
gtattggatgctatcaccaagcatttagacatcggatcctacagagagtggtctgaagag
cgccgccaagaatggcttttatctgagctaagtggcaagcgtccgctcttcggtcctgat
cttcctaaaaccgaagaaatcgctgatgttctcgacacgtttcacgtcatagccgagcta
ccatcagacagctttggtgcttacatcatctccatggcaactgcgccttctgatgtatta
gcggttgagcttttacagcgcgaatgccacgtgaaacggcctttgagagttgttccgctc
tttgagaagctagcggatctcgaagcagctcctgcagcggttgctaggctcttttccgtc
gactggtacaagaaccggattaacggtaagcaagaggttatgatcggttattcagactca
gggaaagacgctggacgtttatccgccgcttggcagttatacaaagctcaagaagagctt
gtgaaggttgctaaagagtatggtgtgaagctaaccatgtttcacggtcgtggtggcacg
gtcggaagaggaggtggaccgacacatcttgctatattgtctcagccaccggatactatc
aacggttcgctccgtgtcacggttcaaggtgaagtcatcgagcaatcattcggagaggaa
catctatgcttcagaacgcttcagcgtttcaccgctgcaacactcgagcacgggatgcgt
cctccggtttcgcctaaaccagaatggcgcgctttgctcgatgaaatggcggttgttgca
accgaagagtaccggtctgttgtgttccaagaacctcggtttgtcgagtacttccgcctc
gctacaccggaactagagtatgggcgtatgaacattggaagcagaccttcgaagcggaaa
ccaagtggcggcatcgaatctctccgtgcgattccgtggatctttgcttggactcaaacg
agattccatctccctgtatggcttggattcggagcagcgattaggcacgtgatcgagaaa
gacgtcaagaacctgcacatgcttcaggatatgtacaaacactggcctttctttagagtc
accattgatctgatcgaaatggtgttcgctaaaggagatcccggtatcgctgccttgtac
gataagcttcttgtttcagaagagctatggcctttcggtgaaaaactcagagccaatttc
gaagaaaccaagaaactcatccttcagactgctggacacaaggatctacttgaagaggat
ccttacttgaaacagagactgagacttcgtgattcttacatcacgactcttaatgtttgt
caagcttacacattgaagaggatccgtgatccgagttaccatgttactctcagacctcat
atctctaaggagattgcagaatcgagcaaatcagcacaagaactcgtcgagcttaacccg
acgagtgagtacgcgcctggacttgaagatacactcatcttgaccatgaagggtatcgct
gcaggtctacaaaacaccggttga

DBGET integrated database retrieval system