KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109440588Help
Entry
109440588         CDS       T04863                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00010  Glycolysis / Gluconeogenesis
rss00053  Ascorbate and aldarate metabolism
rss00071  Fatty acid degradation
rss00280  Valine, leucine and isoleucine degradation
rss00310  Lysine degradation
rss00330  Arginine and proline metabolism
rss00340  Histidine metabolism
rss00380  Tryptophan metabolism
rss00410  beta-Alanine metabolism
rss00561  Glycerolipid metabolism
rss00620  Pyruvate metabolism
rss01100  Metabolic pathways
Module
rss_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109440588
   00053 Ascorbate and aldarate metabolism
    109440588
   00620 Pyruvate metabolism
    109440588
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109440588
   00561 Glycerolipid metabolism
    109440588
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109440588
   00310 Lysine degradation
    109440588
   00330 Arginine and proline metabolism
    109440588
   00340 Histidine metabolism
    109440588
   00380 Tryptophan metabolism
    109440588
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109440588
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109440588
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 DtxR
Motif
Other DBs
NCBI-GeneID: 109440588
NCBI-ProteinID: XP_019576320
LinkDB All DBs
Position
Unknown
AA seq 540 aa AA seqDB search
MASRRVSSLLSRSVMSSPSLSSLRGKAPHMNRGGHRYSNLAAAAAALENTITPPVKVEHT
QLLIGGKFVDAASGKTFPTLDPRTGEVIAQVAEGDKEDVNRAVLAARKAFDEGPWPRMTA
YERSKILFRFADLIEKHNDEIAALETWDNGKPFEQSAKIEVPMIARVFRYYGGWADKIHG
MTVPGDGSHHVQTLHEPIGVAGQIIPWNFPLVMLSWKLGPALACGNTVVLKTAEQTPLSA
LLVGRLLHEAGLPEGVVNIVSGFGPTAGAAIASHMDIDKVAFTGSTDVGKIILELASKSN
LKAVTLELGGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEK
AKARAINRAVGDPFKSGIEQGPQVDSEQFKKILKYIKHGVDNGATLQAGGDRLGSKGYYI
QPTVFSDVKDDMLIATDEIFGPVQTILKFKDLDEVIARANNSRYGLAAGVFTQNLDTANR
LMRALRVGSVWINCFDVFDATIPFGGYKMSGIGREKGIYSLSNYLQVKAVVTAIKNPAWL
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagaagagtttcttcgctgctctctcgctccgtcatgtcctcgccttccctt
tcctctcttagaggcaaagcccctcacatgaacagaggaggtcacagatacagcaacctc
gctgctgcagctgctgctctcgagaacacgattactccacctgtgaaagtggagcacacg
cagctccttatcggcggaaagttcgttgatgcagcctcaggaaaaactttccccactttg
gatccaagaactggggaagtgatcgctcaggtggctgagggtgataaagaagacgtgaac
cgtgcggttttagctgcacgcaaggcctttgatgaaggaccatggcctagaatgacagct
tatgagagatcgaagatactgtttcgtttcgctgacttgatcgagaaacacaacgacgag
attgctgctcttgagacttgggataatgggaaaccttttgaacaatctgccaagattgaa
gtgcctatgattgctagggtgttccggtactatggtggttgggcagacaagatccatgga
atgacggttccaggagatggttcgcaccatgtgcagaccctccacgagcctataggagtc
gctggacagatcatcccatggaacttccctcttgtcatgctttcctggaaacttggacca
gctttagcttgcggtaacaccgttgtcctcaagaccgctgagcaaacccctctatctgct
cttcttgttggaagactacttcacgaggctggacttcccgaaggagttgtcaatatagtt
tctggatttggtcccacagctggtgcagccatagctagtcacatggacattgataaggtt
gctttcaccgggtccactgatgtcggaaagattattcttgagctggcttcgaaaagcaac
cttaaggcagtgactcttgagcttggaggcaagtcaccattcattgtatgtgaagatgct
gatgtggatcaggccgttgagctcgctcatttcgctttgttctttaaccagggacaatgc
tgctgtgctggctcgcgtacgtttgtacatgaacgcgtctatgatgagtttgtggaaaaa
gctaaagctcgtgcaatcaaccgcgcagttggagatcccttcaagtcaggcattgagcaa
ggtcctcaggtggactcagagcaattcaagaaaatcctgaagtacattaaacatggagtt
gataatggagccaccttacaagctggaggtgaccggcttggttccaagggttactacatt
caacccactgtcttctcagatgtgaaagacgacatgctcatagcaacagacgagattttc
ggaccggtccaaaccatactgaagttcaaggatctggatgaggtgattgcgagggcgaac
aactccaggtacggtttagctgcgggagtgttcacacagaatctggacacagcgaatagg
ctaatgcgagcgctcagggttgggagcgtttggataaactgtttcgatgtgtttgatgcc
acaattccatttggagggtataagatgagtggcattggcagagagaaaggtatctacagt
ctcagcaattacttgcaagtcaaggctgttgtcactgccatcaagaacccggcttggctc
taa

DBGET integrated database retrieval system