KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109440747Help
Entry
109440747         CDS       T04863                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B4, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00010  Glycolysis / Gluconeogenesis
rss00053  Ascorbate and aldarate metabolism
rss00071  Fatty acid degradation
rss00280  Valine, leucine and isoleucine degradation
rss00310  Lysine degradation
rss00330  Arginine and proline metabolism
rss00340  Histidine metabolism
rss00380  Tryptophan metabolism
rss00410  beta-Alanine metabolism
rss00561  Glycerolipid metabolism
rss00620  Pyruvate metabolism
rss01100  Metabolic pathways
Module
rss_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109440747
   00053 Ascorbate and aldarate metabolism
    109440747
   00620 Pyruvate metabolism
    109440747
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109440747
   00561 Glycerolipid metabolism
    109440747
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    109440747
   00310 Lysine degradation
    109440747
   00330 Arginine and proline metabolism
    109440747
   00340 Histidine metabolism
    109440747
   00380 Tryptophan metabolism
    109440747
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109440747
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109440747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 109440747
NCBI-ProteinID: XP_019576483
LinkDB All DBs
Position
Unknown
AA seq 530 aa AA seqDB search
LLSRSFSASSPFLFRSQGRNCYNGSRIVRRFGSSSAAEEIISPSVQVSYTQLLIDGNFVD
AASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMTAYERSRIMLRF
ADLVEKHSEELASLETWDNGKTYEQAKTAEIPMLARLFRYYAGWADKIHGLTVPADGNYH
VQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTAFYVGKLFLEA
GLPPGVLNIVSGFGPTAGAALASHMDVDKLAFTGSTDTGKVILGLAANSNLKPVTLELGG
KSPFIVFEDADINKAVELAHFALFFNQGQCCCAGSRTYVHEKVYDEFVEKAKARALKRVV
GDPFKKGIEQGPQIDSKQFEKVMRYIRSGVESNATLECGGDRIGDKGYFIQPTVFSDVKD
DMLIAQDEIFGPVQSILKFRDVDEVIRRANETRYGLAAGVFTKSLDTANRVSRALKAGTV
WVNCFDVFDAAIPFGGYKMSGNGREKGIYSLNNYLQVKAVVTPLNNPAWI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
ctcttatcacgatccttttcagcttcctctccctttctctttcgttctcaagggagaaat
tgttacaatggaagtaggatcgtacggagattcggatcctcttctgcagctgaagaaatc
ataagcccgtcagttcaagtttcttacacacagctcctcatcgatgggaacttcgtagat
gctgcttctggtaagacgtttccgactcttgatccacgcacaggggaagtcattgctcac
gtagctgaaggcgatgctgaagatatcaatcgggcggtgaaagctgcaaggaaggccttt
gatgaaggaccttggcctaagatgactgcttatgaaagatcaaggataatgctgagattc
gcagatttggttgagaaacacagcgaagagctcgcgtctctagagacatgggacaatggg
aagacttatgaacaagccaaaacagcagagataccaatgctcgccagattgttccgctac
tatgctgggtgggcggataagattcatgggcttacagttccagctgatgggaactatcat
gttcagacattacatgaaccgataggcgttgctggacagatcattccgtggaactttccg
cttttgatgtttgcttggaaagttggtcctgctcttgcttgtggtaacaccattgtcctc
aaaaccgctgaacaaactcctctcactgctttctacgtcggcaaacttttccttgaagcg
ggtcttcctcctggtgttctgaatatagtttctggattcggtccaaccgctggtgctgct
ctcgcgagtcacatggatgtagacaagcttgctttcacagggtctactgatactggcaaa
gtcatacttggacttgctgctaacagcaatctcaagccggtgaccctagaactgggaggg
aaatcaccgttcatcgtgttcgaagatgctgatatcaataaagctgtagagcttgcacac
tttgctctcttcttcaatcaggggcaatgttgctgcgcagggtctcggacatacgttcat
gagaaagtgtatgatgagtttgttgagaaagcaaaggcacgcgcattaaaacgtgtggtt
ggtgatcctttcaagaaaggcattgaacagggtcctcagatcgattcgaagcaattcgag
aaagtgatgaggtacataaggtcaggtgtcgaaagcaatgctactcttgaatgtggtggt
gatcggattggggacaaaggttacttcatccaacctacagtcttttctgacgttaaggac
gacatgcttatcgctcaagacgagattttcggtccagtccaatcaatcttgaagttcagg
gatgtggatgaggtgataaggagggcgaacgagacgaggtacgggctagccgcaggggtt
ttcacaaagagcttggacactgcaaatagggtgtcgagggctttgaaagctggcaccgtt
tgggttaactgtttcgacgtctttgacgcagccattccctttggtggttacaagatgagc
ggcaacggcagagagaaaggtatatacagtctcaacaactacttgcaggtcaaggcagtc
gtcactcctcttaataaccctgcatggatctga

DBGET integrated database retrieval system