KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109441096Help
Entry
109441096         CDS       T04863                                 

Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00250  Alanine, aspartate and glutamate metabolism
rss00410  beta-Alanine metabolism
rss00430  Taurine and hypotaurine metabolism
rss00650  Butanoate metabolism
rss01100  Metabolic pathways
rss04727  GABAergic synapse
rss04940  Type I diabetes mellitus
Module
rss_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    109441096
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    109441096
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109441096
   00430 Taurine and hypotaurine metabolism
    109441096
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    109441096
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    109441096
Enzymes [BR:rss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     109441096
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 109441096
NCBI-ProteinID: XP_019576835
LinkDB All DBs
Position
Unknown
AA seq 494 aa AA seqDB search
MVLSRTATASDENVCSTFGSRYVRTALPKYEIGENSIPKDAAYQIIKDELMLDGNPRLNL
ASFVTTWMEPECDKLIMDSINKNYVDMDEYPVTTELQNRCVNMIARLFNAPLEATETAMG
VGTVGSSEAIMLAGLAFKRNWQNKRKAEGKPYDKPNIVTGANVQVCWEKFARYFEVELKE
VKLTEGYYVMDPDKAAEMVDENTICVAAILGSTLNGEFEDVKRLNDLLVKKNEETGWDTP
IHVDAASGGFIAPFIYPDLEWDFRLPLVKSINVSGHKYGLVYAGIGWVVWRTTKDLPDEL
IFHINYLGADQPTFTLNFSKGSSQIIAQYYQLIRLGFEGYKNVMENCRENMVVLKEGIEK
TERFNIVSKDIGVPLVAFSLKDHSFHNEFEISEMLRRFGWIVPAYTMPADAQHITVLRVV
IREDFSRTLAERLVADIVKVLHELDTLPSKISRKMGAEDFGNVKGKKVEREMLMEVIVGW
RKFVKDRKKMNGVC
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggttctgagtcgaacagccacggcgagtgacgaaaacgtttgctccacgttcggatct
cgctatgtccgaactgcacttcccaagtatgagattggtgagaattcgataccgaaggac
gctgcgtatcagatcataaaagatgagctgatgcttgatggtaacccgaggctgaacctg
gcttctttcgtgaccacatggatggagccagagtgtgataaactcattatggactctatc
aacaagaactacgtcgacatggacgagtaccctgtcactaccgagctccagaaccgatgt
gtcaacatgatagctcgattgttcaatgcgccacttgaagcaactgagacagccatggga
gtagggacggttgggtcttcagaggccatcatgttagccggattggccttcaaaaggaat
tggcagaacaaacgcaaagctgagggtaaaccttatgacaaacccaacattgtcaccgga
gccaatgttcaagtgtgctgggaaaaattcgctaggtacttcgaggtggagctaaaagaa
gtgaagctaactgaaggttactacgtgatggatccagacaaagcagcagaaatggtagac
gagaacacaatctgtgtcgctgccattcttgggtccacactcaacggtgagttcgaagac
gtcaaacgactcaatgacttgttggtcaagaaaaacgaagagactggttgggacacacca
atccacgttgacgcagcaagtggaggcttcatagctccgttcatttaccctgacttggaa
tgggactttaggcttcctttggtgaagagtatcaatgtgagtggtcataagtatggtctg
gtctatgctggtattggttgggttgtgtggaggacaacaaaggatttacctgatgagcta
atctttcatatcaactatcttggtgctgatcaacccacatttactctcaatttctccaag
ggatcgagccaaattattgctcaatactaccagctcattcgtcttggcttcgagggctac
aagaatgtgatggagaactgcagagagaacatggtggttctgaaagaagggatagagaaa
acagaacgtttcaacatagtttcaaaggacataggagtgccactggtagctttctctctc
aaggaccatagtttccacaacgagttcgagatctctgagatgctacgccgtttcggctgg
attgtcccggcttacactatgcctgcggatgcgcaacacatcacggttctgcgtgtagtc
attagggaagacttctcaagaacacttgcggagagacttgtggctgatattgtgaaggtg
cttcatgagcttgatacattgccttccaagatatctaggaagatgggagcagaggatttc
ggaaatgtgaaagggaagaaggtggagagggagatgctgatggaagttattgttggatgg
aggaagtttgtgaaggataggaagaagatgaatggtgtgtgttaa

DBGET integrated database retrieval system