KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109441680Help
Entry
109441680         CDS       T04863                                 

Definition
(RefSeq) phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00400  Phenylalanine, tyrosine and tryptophan biosynthesis
rss01100  Metabolic pathways
rss01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    109441680
Enzymes [BR:rss01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     109441680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 109441680
NCBI-ProteinID: XP_019577462
LinkDB All DBs
Position
Unknown
AA seq 396 aa AA seqDB search
FLLQGGDCAESFKEFNANNIRDTFRILLQMGAVLMFGGQVPVVKVGRMAGQFAKPRSDSF
EERNGVKLPSYRGDNINGDAFDSKSRIPDPQRMIRAYCQSAATLNLLRAFATGGYAAMQR
VTQWNLDFTEKSEQGDRYRELAHRVDEALGFMHAAGLTLDHPIMQTTDFWTSHECLLLPY
EQSLTRLDSTSGLYYDCSAHMIWVGERTRQLDGAHVEFLRGVANPLGIKVSDKMDPKELV
KLIEILNADNKPGRITIITRMGAENMRVKLPHLIRAVRRAGQIVTWVSDPMHGNTIKAPC
GLKTRPFDSILAEVRAFFDVHEQEGSHPGGVHLEMTGQNVTECIGGSRTVTFDDLGSRYH
THCDPRLNASQSLELSFIIAERLRKRRIKSQQAFSV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
tttctgttacaaggaggtgattgtgcagagagcttcaaagagttcaacgccaacaacatt
cgtgacaccttcaggattcttctccagatgggtgctgttttgatgttcggtggccaagtc
cctgtcgttaaggttggaagaatggcgggtcaatttgcgaagccgagatcggattcgttt
gaggagaggaacggagtgaaactgccgagttacagaggagataacatcaatggagatgcg
tttgattcgaaatcgaggattcctgacccacagaggatgatcagagcttattgtcaatct
gcagctactttgaatcttttgagagcttttgctactggtggttacgctgctatgcagaga
gttactcagtggaatcttgatttcacagaaaagagtgagcaaggagacaggtaccgtgaa
ctagctcaccgtgttgatgaagcgctcggtttcatgcacgctgctggactcacgctcgat
catcccataatgcaaacaaccgacttctggacttctcatgagtgtctgctcttgccttat
gagcaatcactaacaaggctagactcgacctctggtctctactacgattgttctgctcat
atgatctgggtcggcgagcgaaccaggcagctcgatggagcccacgtcgagttcttgaga
ggtgttgctaatcctcttggaatcaaggtgagtgataagatggatccaaaggagctagtg
aagctgattgagatcttgaatgctgataataaacctggaaggatcacgattatcacaaga
atgggagcagagaatatgagagtgaagcttcctcatttgatcagagctgtgcgacgcgct
ggacagattgtgacttgggtcagtgatccaatgcacggaaacaccattaaggctccttgt
ggtctcaagactcgtccatttgactccatcttggctgaagtgagagcgttcttcgacgtg
cacgagcaagaaggaagccacccgggaggtgttcacctagagatgactggtcagaacgtg
accgagtgcatcggtggttcacgcacagtcacgttcgatgacttgggctcgcgttaccac
acgcactgtgaccctcgcctcaatgcctcgcagtctctcgagctctccttcatcatcgcc
gaacgccttagaaagagacgcatcaagtcccaacaggctttttccgtctaa

DBGET integrated database retrieval system