KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109443515Help
Entry
109443515         CDS       T04863                                 

Gene name
SETD2
Definition
(RefSeq) histone-lysine N-methyltransferase SETD2 isoform X1
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    109443515 (SETD2)
Enzymes [BR:rss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109443515 (SETD2)
Chromosome and associated proteins [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109443515 (SETD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRI SET WW
Motif
Other DBs
NCBI-GeneID: 109443515
NCBI-ProteinID: XP_019579565
LinkDB All DBs
Position
Unknown
AA seq 2564 aa AA seqDB search
MKQLPPQPPPKMGDFYDPEHPTPEEEENEAKSENVQKTGFIKGPMFKGVVASSRFLPKGT
KTKVNLEEQGRQKVSFSFSFTKKTLQNRFLTALGNDKQSDTPNSPSVPLQVDLTSKIKMD
VGDTLSVTEESSPPKSRVELGKIHFKKHLLHVTSRPLLTTTPAVTSPPPPIVTSPAVMAE
STTVDSPPSSPPPPPPPPQAATSSPPAPVTEPVALPHTPITVLMTAPVDVAVRALKEPSV
TIVPESSEVDTKQDTVSDSSEEHIIQNSNEQADIPSQKEDSHIGKEEEIPDSSKSSLSSK
KTGSKKKSSQSESTFLGSESDEDSVRTSSSQRSHDLKFSASIEKERDSKKSLAPLKSEDL
GKSSRSKTERDDKYFSYSKLERDTRYISSRCRSERERRRSRSRSRSDRGSRTSLSYSRSE
RSHYYDSDRRYHRSSPYRERTRYSRPYTDNRARESSDSEDEYKKTYSRRTSSHSSSYRDL
RTSSSYSKSDRDCKTESSYLEMEKRGKHSLKLERESKRTSENETVKRCCSPPNELGFRRG
SSYSKHENSASRYKSTPSKSIPKSDKFKNSFCCTELNEEIKQSHSFSLQTPCSRGSEVRM
ISKNPERKKTGSPSPSNQLNDSPTFRKLEESPIFKSEFIGHDSHGSVKELDSLSKVKNDQ
LRSYCPIELNINGSPGTESDLVTFCTSKTDTVLMSSDDSVTGSEVSPLVEACLLSSNGFQ
NISRCKETDLDDTCMQHSKSESPFRETEPPVSPHQEKLMSSPVMAIDYSKTVVKEPVDLR
VSCCKTKDSDVYCTSNDNNPSLCHSEAEDIEPSVTKISSNSFTNVHLKSKTVICDNSNLT
DQHSKFACEEYKQSVGSTSSASVNHFDDLYQPIGSSDIASSLQSLPPGIKVDSLTLLQCG
ENASPVLDAVLKSKSTEFLKHAEKEIIVEVGSGLPDSGTGFASWENRHNNGLPGKCVHEA
EEEGNSILPDKRGRPELSFDEEGGRVHEHTSDDSEVVFSSCDLNLTMEDSDCVTYTLKCD
SSGHASEIVSTVHEDYSGSSESSSDESDSEDTDSDDSSMPRNRLQSVVVVPKNSTLPMEE
TSPCSSRSSQSYRHYSDHWEDERLESRRHSYEEKFESIASKACPQTEKFFLHKGTEKNPE
VSFTQPCRKQIDKHMPEIAHPQSDGVDSTSHTDVRCDPLGHSNSEETVEAKIASRQQEEL
PVYSDDFEDVPSKCRQQTTFPNRPDSRLGRTELNFSSSYEISRVDGFHSSEELRNLGWDF
PQQEKPTTTYQQPDSSYGACGGHKYHQSADQYGGTRNYWQGNGYWDPRSAGRPPGTGVVY
DRIQGQVPDSLTDDREEEENWDQRGGPHFSSQSSKFFSSLQKDKGSVQAPEISSNSIKDS
LAVNEKKDLSKNLEKSDMKDRGPPKKRRQELESDSESDGELQDRKKVRVEIEQGETTVAP
GSALIGPSCVMEDFRDPQRWKECAKQGKMPCYFDLIEENVYLTERKKNKSHRDIKRMQCE
CTPLSKDERAQGEIACGEDCLNRLLMIECSSRCPNGDYCSNRRFQRKQHADVEVILTEKK
GWGLRAAKDLPSNTFVLEYCGEVLDHKEFKARVKEYARNKNIHYYFMALKNDEIIDATQK
GNCSRFMNHSCEPNCETQKWTVNGQLRVGFFTTKLVPSGSELTFDYQFQRYGKEAQKCFC
GSANCRGYLGGETRVSIRAAGGKMKKERSRKKDSVDGELEALMENGEGLSDKNQVLSLSR
LMVRIETLEQKLTCLKLIQNTHSQSCLKSFLERHGLSLLWIWMAELGEGRESNQKLQEEI
IKTLEHLPIPTKNMLEESKVLPIIQRWSQTKIAVPQLSEGDGYSSENTSRAHTPLNTPDP
STKLSTEADTDTPKKLVFRRLKIISENSMDSAISDATSELEGKDGKEDLDQLENVPVEEE
EELQSQQLLTQQLPGSKVDSEIVVEASKLPTSEPEADTDIEPKESHSTKLEEHIAEETPS
QDEEEGVSDVESERSQEQPDKTVDISDLATKLLDSWKDLKEVYRIPKKSQTEKENAITER
GRDAVGFRDQTTAPKTPNRSRERDPDKQTQNKEKRKRRGSLSPPSSAYERGTKRPDDRYD
TPTSKKKVRIKDRNKLSTEERRKLFEQEVAQREAQKQQQQMQNLGMTSPLPYDSLGYNAP
HHPFAGYPPGYPMQAYVDPSNPNAGKVLLPTPSMDPVCSPAPYDHSQPLVGHSTEPLAAP
PPVPVVPHVTAPVEVSSSQYVAQSDGVVHQDSSVAVLPVPAPGPVQGQNYGVWDSNQQSV
SVQQQYSPAQSQATIYYQGQTCPTVYGVTSPYSQTTPPIVQSYAQPSLQYIQGQQIFTAH
PQGVVVQPTAAVTTIVAPGQPQPLQPPEMVVTNNLLDLPPPSPPKPKTIVLPPNWKTARD
PEGKIYYYHVITRQTQWDPPTWDSPGDDASLEHEAEMDLGTPTYDENPMKTSKKPKTAEA
DTSSELAKKSKEVFRKEMSQFIVQCLNPYRKPDCKVGRITTTEDFKHLARKLTHGVMNKE
LKYCKNPEDLECNENVKHKTKEYIKKYMQKFGAVYRPKEDTELE
NT seq 7695 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctgccgccgcagccacctccgaagatgggggatttctacgaccccgagcac
ccgacccctgaagaagaagaaaatgaggcaaagagtgaaaatgtgcagaaaacaggtttc
atcaaaggaccaatgttcaaaggtgttgttgcttctagtcggtttttgcccaaaggcacc
aagacaaaagttaatttggaggaacagggacgacagaaggtgtcattcagcttcagcttt
acaaagaaaactttgcagaacaggtttctaactgcacttggcaatgacaagcaaagtgat
actccaaactccccatctgtacctcttcaagtagacttgacctctaaaattaaaatggat
gttggagataccttatctgttacagaagaatcttccccaccaaaatcaagggtagaattg
ggcaaaattcattttaagaaacatcttcttcatgtaacatccaggcctctgctgactact
accccagcagtgacatctccacctcctcccatagtaacctcaccagcagtcatggcagaa
tcaacaactgtagactcgccaccctcatctccacctcccccacctccacctccccaagcc
gcaacatcctcaccaccagcaccagtaacagagccagtggccttgccacacacaccgata
acagttctgatgacagcaccagtcgatgtagcagttagagccctaaaggaaccatcggtt
acaattgtaccagaatcttcagaagtggacactaagcaggacaccgtatcggacagttcc
gaagaacacatcattcagaattcaaatgagcaagcagatattccctcacaaaaagaagat
tcccatattgggaaggaagaagaaattccagatagttctaagagtagtctgagctctaaa
aaaacaggttctaagaagaaatcctcccaatcagaaagcacctttcttggctcagaatct
gatgaagattctgtacggacttcctcaagtcagagatcacatgatttaaaattttcagca
agcattgaaaaggaaagagattcaaaaaagagtttagcgcctttaaaaagtgaggattta
gggaaatcttcacgatctaaaacagaaagagatgataagtattttagctactcaaaactt
gaaagagatactcgatatatatcctctcgatgtagatcagagagagagcgaaggcgaagc
agatctcgttctaggtctgacagaggctctagaactagcttatcctattcccggtcagaa
cgatcccattattatgactctgatcgtcgctaccataggagttccccttatcgagagagg
acacgctattctcggccatatacagataacagggcacgagagagttctgactcagaagat
gagtataagaagacatactcaaggcgcacctcatctcattcctcctcttacagagaccta
aggacatcatcgtcctattctaagtctgatcgggactgcaaaactgagtcctcttactta
gagatggagaaaagaggaaaacattctttaaaactagaaagagaatccaaaaggacttca
gaaaatgaaacagtgaaaagatgttgttctccccctaatgaactgggattccgacggggg
tcatcatattccaagcatgaaaacagtgcttcccgttataaatctactccttcaaaatct
atacccaagtctgataaatttaaaaattctttctgttgtacagaattaaatgaggaaatc
aaacagtctcattcttttagtttacagactccttgttcaagaggtagcgaagtaagaatg
attagtaaaaatcctgaaagaaaaaagactggatctccatctccatcaaatcaattaaat
gattcacctacatttagaaagctagaagaatcgcctatttttaagtctgaatttatagga
cacgatagccatggtagtgttaaggaattagactctttatctaaagtgaagaatgatcaa
ttaagaagctactgtcccatagaattaaatataaatggttctccggggacagaatctgat
ttggtaacattttgcacttctaaaactgacactgttttgatgtcttctgatgatagtgtg
actggatcggaggtatccccgttggtcgaagcatgtctgctttcatcaaacggatttcag
aatattagtagatgtaaagaaacagatttggatgatacttgcatgcaacatagtaagtca
gaaagcccatttagagaaacagaacctccagtgtcaccacatcaagaaaaactcatgtct
tctccagtcatggctatagattattccaaaacagtagttaaagaaccggttgatttgagg
gtttcttgctgtaaaaccaaagattcagatgtatactgtacttcaaatgacaacaaccct
tctttgtgtcattccgaagctgaagatattgagccttcagttacgaagatttcttcaaat
agctttacgaatgtgcatttgaaatcaaaaacagttatatgtgataacagtaatctgaca
gatcagcactcgaaatttgcatgtgaagaatataagcagagtgttggtagcactagttca
gcttctgttaatcattttgatgatttatatcaaccaatagggagttcagacattgcttca
tctcttcagagtcttccaccaggaataaaagtggacagtttaactctcttacaatgtgga
gagaacgcatctccagttttggatgctgtgctgaagagtaaaagcacagagtttttgaag
catgcagaaaaagaaataatagtagaagtaggtagtggcctacctgattcaggaacagga
tttgcttcctgggaaaaccggcataataatgggttacctgggaaatgtgtgcatgaggct
gaagaagaagggaattccattttgcccgataaaagaggaagaccagaactctcttttgat
gaagaaggaggaagagtacatgaacacacctctgacgattcagaagttgtattttcttct
tgcgatttgaatttaaccatggaagacagtgactgtgtaacatacaccttaaaatgtgac
agtagtggtcatgcctcagagattgtgtctactgttcatgaagattattctggttcctct
gaaagttcaagtgatgaaagtgattcggaagatacagattctgatgatagcagtatgcca
agaaaccgtcttcagtcagtcgtggttgtgccaaagaattctactttgcccatggaagaa
acaagtccttgttcttctcggagcagtcaaagttacagacactattctgaccattgggaa
gatgagagattggagtcaaggagacattcatatgaggaaaaatttgagagcatagcaagt
aaagcctgtcctcagactgagaagttcttccttcataaaggaacagagaagaatccagaa
gtttcttttacacagccttgcagaaaacaaattgataagcacatgcctgaaattgctcat
cctcagagtgatggggttgacagtacaagtcacactgatgtgagatgtgaccctctaggt
cattcaaattctgaggaaacagtggaagccaaaatagcttctaggcagcaagaagagttg
ccggtttattctgatgattttgaagatgtcccaagtaagtgtcggcaacagaccactttc
ccgaataggccagatagtagactgggaagaacggagctgaatttttcttcctcttacgag
atctcccgagtggatggcttccattcatcggaagagctcagaaacctagggtgggacttc
cctcagcaagagaagcctaccaccacctatcagcagcctgacagcagctatggagcctgt
ggtggacacaagtatcaccaaagtgcagatcagtatggtgggacacgtaattactggcaa
ggcaacggctactgggatccaaggtcagcaggcagacctcctggcacgggggttgtgtat
gatcgaattcaagggcaggtgccagattccttaacagatgaccgtgaagaggaagagaat
tgggatcagcgtgggggacctcacttttcaagccagtccagtaaatttttctcatccctt
cagaaggacaagggatcagtgcaagcacctgaaataagcagcaattctattaaggactct
ttagctgtgaatgaaaagaaagatctttcaaaaaacttagaaaaaagtgatatgaaagat
agagggcctcctaaaaaaaggaggcaggaattggagagtgattctgaaagtgatggtgag
cttcaggacagaaagaaagttagagtggagatagagcagggggagaccacagtggcccca
ggatcagcgctgattgggccttcatgtgtcatggaggacttcagggacccacagcgatgg
aaggaatgtgccaagcaagggaagatgccttgttactttgatctgattgaagaaaatgtt
tatttaacagaaagaaagaagaataaatcccatcgggatattaagcgaatgcagtgtgag
tgtacacctctttctaaagatgaaagagctcaaggtgaaatagcatgtggggaagattgt
cttaatcgtctcctcatgattgaatgttcttcccggtgtccaaatggggattattgttcc
aatagacggtttcagagaaaacagcatgcagatgtggaagtcatactcacagaaaagaaa
ggctggggcttgagagctgccaaagaccttccttccaacacctttgtcctggaatattgt
ggagaggtacttgatcataaagagtttaaagcccgggtaaaggagtatgcacgaaacaaa
aacatccactactatttcatggccctgaagaatgatgagataatagatgccactcagaaa
ggaaattgctctcgtttcatgaatcacagctgtgaaccaaactgtgagactcaaaaatgg
actgtgaatggacagctgagggttgggttttttaccaccaaactggttccttcaggctca
gagttaacatttgactatcagttccaacgatatggaaaagaagctcagaaatgtttctgt
gggtcagctaattgccggggttacctgggaggagagactagagtcagcatcagagcagca
ggagggaaaatgaagaaggaacgctctcgtaagaaggattcagtggatggagagctagaa
gctctgatggagaatggtgagggtctctctgataaaaatcaggttctcagcttatcccgg
ctaatggttagaattgaaactttggagcagaagcttacctgtctcaagctcatacagaac
acacattcacagtcttgcctgaagtcttttctggaacgtcatgggctgtctttgttgtgg
atctggatggcagagctaggtgaaggccgggaaagtaaccagaaacttcaggaagagatt
ataaagactttggaacacttacccattcctactaaaaatatgttggaggaaagcaaagtg
cttccaattattcaacgttggtctcagaccaagattgctgtccctcagttgagtgaagga
gatgggtattctagtgagaatacgtcacgtgctcacacaccactcaacacacctgatcct
tccaccaagctgagcactgaagcggacacagacacccccaagaagctggtgtttcgtaga
cttaaaattataagtgaaaatagcatggacagtgcaatctctgatgctaccagcgagcta
gaaggcaaagatggcaaagaggaccttgaccagttagaaaacgtccctgtagaagaagag
gaagaattacagtcacaacagctactcacacaacagctgcctggatcgaaagttgatagt
gaaattgttgtggaggccagtaagctacccacgtctgaaccagaggctgatactgacata
gagcctaaagagagccatagcacaaaactggaagaacatattgctgaggaaacaccatcc
caagatgaagaggagggtgtatctgatgtagagagtgagagaagccaggagcagcctgat
aaaacagtagatataagtgatttggccaccaaactcctggacagttggaaagatctaaag
gaagtatatcgaattccaaagaaaagtcaaactgaaaaggagaatgcaataactgaacga
ggaagggatgctgttggcttcagagatcaaacaactgccccaaagactcctaacaggtca
agagagagagacccagacaagcaaactcaaaataaagagaaaaggaaacgaaggggttcc
ctctcaccaccttcttctgcctatgagcggggaacaaagaggccagatgacaggtatgat
acaccaacttctaaaaagaaagtgcgaattaaagaccgcaataaactttctacagaggag
cgtcggaagttgtttgagcaagaagtggctcagcgggaggctcagaaacagcagcagcag
atgcagaacctggggatgacatctccactcccctatgactctcttggctacaacgcccct
catcacccctttgctggctacccaccaggttatcccatgcaggcctatgtggatcccagc
aaccctaatgctggaaaggtgctcctccccacacccagcatggaccccgtgtgttctccc
gctccttatgatcattctcagcccttggtgggacactctacggaaccccttgctgcccct
ccacctgtgccagtggtgccacatgtgacagcccctgttgaagtttccagttcacagtat
gtggcccaaagtgacggtgtggtccaccaagactctagcgttgctgtcttgccagtgccg
gccccaggcccagtccagggacagaattatggtgtttgggattcaaaccaacagtccgtc
agtgtacagcagcagtactctcctgcacagtctcaagcaaccatatattatcaaggacag
acttgtccaactgtttatggtgtgacatcaccctattcacagacaactccaccaattgta
cagagttatgcccagccaagtcttcagtacatccagggacaacagattttcacagctcac
ccacaaggagtggtggttcagccaaccgcggccgtgactacaatagttgctccagggcag
cctcagcccttacagccacctgaaatggttgtgacaaataatctcctggatctgccaccc
ccctctcctccaaaaccaaaaaccattgtcttacctcccaactggaagacagcgcgagat
ccagaagggaagatttattactaccatgtgatcacaaggcagactcagtgggatcctcct
acttgggacagcccaggagatgatgccagccttgagcatgaagctgagatggacctggga
accccaacatatgacgaaaaccccatgaagacctcaaaaaagcctaagacggcagaagca
gacacctccagtgagctggctaagaaaagcaaagaagttttcagaaaagagatgtcccag
ttcattgtccagtgcctgaacccttaccggaaacctgactgcaaagtgggaagaattacc
acaactgaagacttcaaacatctagctcgcaagctgactcacggcgtaatgaacaaggag
ctgaagtactgtaagaaccccgaggacctggagtgcaatgagaatgtgaaacacaaaacc
aaggagtacatcaagaagtacatgcagaagtttggggctgtgtacagacccaaagaggac
actgaattagagtga

DBGET integrated database retrieval system