KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109444025Help
Entry
109444025         CDS       T04863                                 

Gene name
GSTO1
Definition
(RefSeq) glutathione S-transferase omega-1 isoform X1
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00480  Glutathione metabolism
rss00980  Metabolism of xenobiotics by cytochrome P450
rss00982  Drug metabolism - cytochrome P450
rss00983  Drug metabolism - other enzymes
rss01100  Metabolic pathways
rss01524  Platinum drug resistance
rss05200  Pathways in cancer
rss05204  Chemical carcinogenesis
rss05225  Hepatocellular carcinoma
rss05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    109444025 (GSTO1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    109444025 (GSTO1)
   00982 Drug metabolism - cytochrome P450
    109444025 (GSTO1)
   00983 Drug metabolism - other enzymes
    109444025 (GSTO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109444025 (GSTO1)
   05204 Chemical carcinogenesis
    109444025 (GSTO1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    109444025 (GSTO1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    109444025 (GSTO1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    109444025 (GSTO1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rss02000]
    109444025 (GSTO1)
Enzymes [BR:rss01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     109444025 (GSTO1)
Transporters [BR:rss02000]
 Other Transporters
  Pores ion channels [TC:1]
   109444025 (GSTO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin Glutaredoxin2_C
Motif
Other DBs
NCBI-GeneID: 109444025
NCBI-ProteinID: XP_019580635
LinkDB All DBs
Position
Unknown
AA seq 241 aa AA seqDB search
MSGGSARSLEKGSAPPGPVPDGVIRVYSMRFCPFAERTRLVLKAKGIPHEVININLKNKP
DWFFKKNPFGLVPVLENSQGQLVYESAITCEYLDEVYPGKKLLPEDPYEKACQKMTFELF
SKIPPLVGRFLRSKNKEDRSGIKEEFRKEFSKLEEVLTNKKTTFFGGSSLSMIDYLIWPW
FERLEGLELTECVDHTPKLKLWMAAMRKDPTVSALLLDMKTYRGFLDLYLQDSVQACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtctggaggatcagccaggagcctagagaaggggagcgcgcccccaggaccagtcccg
gatggcgtgatccgcgtctatagcatgaggttctgcccgttcgccgagaggacgcgcctt
gtcctgaaggccaagggaatcccgcatgaagtcatcaacatcaatctgaaaaataagcct
gattggttctttaagaagaatccctttggtctggtgccagttctggaaaacagtcagggt
caactggtctacgaatctgccatcacttgtgagtacctggatgaagtatatccagggaag
aagctgttgccggaagacccctatgagaaagcatgccagaagatgacctttgagttattt
tctaagataccacctttggtgggacgctttcttagaagtaaaaataaggaagaccgttct
ggcataaaagaagaatttcgtaaagaattcagcaagcttgaggaggtgctgaccaataag
aagacaaccttctttggaggcagttcactttctatgattgattacctcatctggccctgg
tttgaacggctggaaggactggagttaactgagtgtgtagaccacactccaaaacttaag
ctctggatggcagccatgaggaaagatcccacagtatcagccctcctccttgatatgaag
acctatcgaggtttcttagatctctacttgcaggacagcgtccaggcctgtgactatggg
ctctga

DBGET integrated database retrieval system