KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109447178Help
Entry
109447178         CDS       T04863                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00590  Arachidonic acid metabolism
rss01100  Metabolic pathways
rss04611  Platelet activation
rss04726  Serotonergic synapse
rss04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109447178 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109447178 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    109447178 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    109447178 (PTGS1)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109447178 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 109447178
NCBI-ProteinID: XP_019586805
LinkDB All DBs
Position
Unknown
AA seq 600 aa AA seqDB search
MSRRSFSLQFPLLLLLLLPSPVLAADPREPPPVNPCCYYPCQHQGICVRFGRDGYQCDCT
RTGYSGPNCTIPELWTWLRNSLRPSPSVLHFLLTHGRWFWEFVNATFIRDMLMRLVLTAR
SNLIPSPPTYNSAHDYISWESFSNMSYYTRVLPSVPQDCPTPMGTKGKKQLPDAQFLSHR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDFGHVYGDNLER
QYELRLFKDGKLKYQVLNGEMYPPSVEEARVVMRYPRGIPPQSQMAVGQEVFGLLPGLML
YATLWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFSSQFQYRNRIALEFNQLYHWHPLMPDSFKVGAQEYSYEQFLFNTSMLVDYGVE
ALVDAFSRQIAGRIGGGRNLDEHVLYVAMDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
FTGEEEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPIC
SPEYWKSSTFGGEMGFNLVKTATLKKLVCLNTKTCPYVSFRVPDAHEDDGPGVERPSTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcggagtttctcgctccagttcccactgctcctgctgttgctgttgccgtcc
ccggtcttagctgcggaccccagggagccccctccggtgaacccctgttgttactaccca
tgccagcaccagggcatctgtgtccgctttggccgtgacggctaccagtgtgactgcacc
cgcacgggctattccggccccaactgtaccatccctgagctatggacctggctccggaat
tcactgcggcccagcccctctgtcctccacttcctgctgacacatgggcgctggttctgg
gagtttgtcaatgccaccttcatccgagacatgctcatgcgcctggtactcacagcacgt
tccaaccttatccccagcccccccacctataactcggcacatgactacatcagctgggag
tccttctccaatatgagctattacactcgtgttctgccctctgtgccccaagactgcccc
acgcccatggggactaaagggaagaagcagttaccagatgcccagttcctgagccatcgc
ttcctgcttaggaggaagttcatacctgacccacaaggcaccaacctcatgtttgccttc
tttgcgcaacactttacccaccagttcttcaaaacttctggcaagatgggtcctggcttc
accaaggccttgggccacggggtagacttcggccatgtttatggagacaatctggaacgg
cagtatgagctgcggctttttaaggatgggaaactcaagtaccaggtgctgaacggagag
atgtacccgccatcggtggaagaggcacgtgtggtgatgcgctacccacggggcattccg
ccccagagccagatggctgtgggccaggaggtgtttggactgcttcctgggctcatgctt
tacgccaccctctggctgcgtgagcacaaccgtgtgtgtgacctgctgaaggctgagcac
cccacctggggcgatgagcagcttttccagacggcccgcctcatccttatcggagagacc
attaagattgtgattgaggagtacgtgcagcagctgagtggctacttcctgcagctcaag
ttcgacccagagctgctgttcagcagccagttccagtaccgtaatcgtattgccctggag
ttcaaccagctataccactggcacccgctcatgcccgactccttcaaggtgggcgcccag
gagtacagctacgagcagttcctgttcaacacctccatgctggtggactatggggtcgag
gccctagtggatgctttctctcgccagatagccggccggatcggtgggggtaggaactta
gatgagcatgtcctgtacgtggccatggatgtcatcaaggaatctcgagagctgcggctg
cagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaggag
ttcacaggagaggaggagatggcagctgagttggaggagctatacggagacattgatgcc
ttggagttctacccgggactgcttcttgagaagtgccatccaaactccatctttggggag
agtatgatagaaattggggctcccttttccctcaagggcctcttagggaatcccatctgt
tctcctgaatattggaagtcgagcacatttggtggcgagatgggcttcaaccttgtgaaa
acagccacactgaagaagctggtctgcctcaacaccaagacttgtccctacgtttcgttc
cgtgtgcccgacgcccacgaggatgatggccctggtgtggagcggccatccacagagctc
tga

DBGET integrated database retrieval system