KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109447739Help
Entry
109447739         CDS       T04863                                 

Gene name
ALDH7A1
Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00010  Glycolysis / Gluconeogenesis
rss00053  Ascorbate and aldarate metabolism
rss00071  Fatty acid degradation
rss00260  Glycine, serine and threonine metabolism
rss00280  Valine, leucine and isoleucine degradation
rss00310  Lysine degradation
rss00330  Arginine and proline metabolism
rss00340  Histidine metabolism
rss00380  Tryptophan metabolism
rss00410  beta-Alanine metabolism
rss00561  Glycerolipid metabolism
rss00620  Pyruvate metabolism
rss01100  Metabolic pathways
Module
rss_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
rss_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109447739 (ALDH7A1)
   00053 Ascorbate and aldarate metabolism
    109447739 (ALDH7A1)
   00620 Pyruvate metabolism
    109447739 (ALDH7A1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    109447739 (ALDH7A1)
   00561 Glycerolipid metabolism
    109447739 (ALDH7A1)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    109447739 (ALDH7A1)
   00280 Valine, leucine and isoleucine degradation
    109447739 (ALDH7A1)
   00310 Lysine degradation
    109447739 (ALDH7A1)
   00330 Arginine and proline metabolism
    109447739 (ALDH7A1)
   00340 Histidine metabolism
    109447739 (ALDH7A1)
   00380 Tryptophan metabolism
    109447739 (ALDH7A1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    109447739 (ALDH7A1)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     109447739 (ALDH7A1)
    1.2.1.8  betaine-aldehyde dehydrogenase
     109447739 (ALDH7A1)
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     109447739 (ALDH7A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 109447739
NCBI-ProteinID: XP_019587952
LinkDB All DBs
Position
Unknown
AA seq 566 aa AA seqDB search
MGSRGRGAGLYFCGSSGRRRVAHPGLSMWRVPRQLCVQIARGSKLSGLWNKPAAFMSTLL
INQPQYAWLKELGLGEENPGVYNGSWGGRGEVITTYCPANNEPIARVRQASVADYEETVK
KAREAWRIWADIPAPKRGEIVRQIGDALRDKIQVLGNLVSLEMGKIFVEGVGEVQEYVDV
CDYAVGLSRMIGGPILPSERPGHVLIEQWNPVGLVGVITAFNFPVAVYGWNSAIAMICGD
VCLWKGAPSTSLISVAVTKIIAKVLEDNKLPGAICSLTCGGADIGTAMAKDEQVDLLSFT
GSTQVGKQVALMVQERFGRSLLELGGNNAIIVFEDADLNLVIPSALFAAIGTTGQRCTTA
RRLFLHESIHDEVVNKLQKAYAQIRVGDPWDPNVLYGPLHTKQAVSMFRGAVEAAKKEGG
TVVYGGKVMDRPGNYVEPTIVTGLPHNASIAHTETFAPILYVFKFKNEEDVFAWNNEVKQ
GLSSSVFTKDLGRIFRWLGPKGSDCGIVNVNIPTSGAEIGGAFGGEKHTGGGRESGSDAW
KQYMRRSTCTINYSKDLPLAQGIKFQ
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgggctctcgcgggcggggggcggggctctatttctgcggctcctcgggccgcaggcgc
gttgcacatcccgggctcagtatgtggcgcgtaccccgccagctgtgtgtgcagattgca
agggggagcaaactctcaggactttggaacaaacctgcagccttcatgtccactctgctt
atcaatcagccccagtatgcgtggctgaaggagctgggcctcggcgaggaaaacccgggc
gtgtataacggcagctggggcggccggggagaggttatcactacctattgtcctgctaac
aatgagccaatagcaagagtccgacaggccagtgtagctgactatgaggaaactgtaaag
aaagcgagagaagcatggagaatctgggcagacattcctgctccaaagcgaggagaaata
gtgagacagattggtgatgccttgcgggacaagatccaagtactgggaaacttggtgtct
ttagagatggggaaaatcttcgtggaaggagtgggagaagttcaagagtacgtggatgtt
tgtgattatgctgttggcttgtcacggatgatcgggggacccatcctgccctctgaaaga
cctggccatgtgctcattgaacagtggaatcctgtaggcctggttggagtcatcactgcg
ttcaacttccctgtggccgtgtacggctggaacagcgccattgcaatgatctgtggggac
gtctgcctttggaaaggagctccatcaacttcccttattagtgttgctgtcacaaagata
atagccaaggttctggaggacaacaagctgcctggtgccatttgctccttgacatgtggt
ggagcagatattggcacagcaatggccaaagatgagcaggtggacctgctgtccttcacc
gggagcactcaggtggggaagcaggtggcccttatggtgcaggagaggtttgggagaagc
ttattagaacttggaggaaacaatgccattattgtttttgaggatgcggacctcaattta
gtcattccatcagctctctttgcggctatcgggacgactggccagaggtgtaccactgcg
aggcgcctgtttttacatgaaagcatccatgatgaagttgtaaataaacttcagaaggcc
tatgcacagatccgggttggggacccatgggaccctaatgttctctacgggccactgcac
accaaacaggcagtgagcatgtttcgtggagcagtggaggccgccaagaaagaaggtggc
acagtggtctatggtggcaaggttatggatcgccctggaaactatgtggaaccgacaatt
gtgacgggccttccccacaatgcatccattgcacatacagagacttttgctccaattctt
tatgtctttaaattcaagaatgaagaagacgtctttgcatggaataatgaagtaaaacag
ggactttcaagtagcgtctttaccaaggatttgggcagaatcttccgctggcttggaccg
aaaggatcagactgtggaatcgtaaatgtcaatattccaacgagtggggctgagattgga
ggtgcctttggaggagaaaagcacaccggtggtggcagggagtctggtagtgatgcctgg
aaacagtacatgagaagatctacttgtaccatcaactacagtaaagaccttcctctggcc
caaggaatcaagtttcagtga

DBGET integrated database retrieval system