KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109448051Help
Entry
109448051         CDS       T04863                                 

Definition
(RefSeq) angiotensin-converting enzyme isoform X1
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04614  Renin-angiotensin system
rss04924  Renin secretion
rss05142  Chagas disease (American trypanosomiasis)
rss05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:rss00001]
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    109448051
   04614 Renin-angiotensin system
    109448051
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    109448051
  09167 Infectious diseases
   05142 Chagas disease (American trypanosomiasis)
    109448051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:rss01002]
    109448051
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rss04147]
    109448051
   04090 CD Molecules [BR:rss04090]
    109448051
Enzymes [BR:rss01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     109448051
Peptidases [BR:rss01002]
 Metallo Peptidases
  Family M2
   109448051
Exosome [BR:rss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109448051
CD molecules [BR:rss04090]
 Proteins
  109448051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-GeneID: 109448051
NCBI-ProteinID: XP_019588537
LinkDB All DBs
Position
Unknown
AA seq 1314 aa AA seqDB search
MGAASGHPELGPRPPLQPLPLPLLMLLLLLPPSPPSALALDPALEPGDFPADEAGAQLFV
QSFNPKAEQVLYQSTVASWAHDTNITEENARRQEESALLNQEFAEVWGQKAKELYDPIWQ
NFSDPILRRVLSGVRILGPANLPLEKRQQYNSLLSNMNRIYSTVKVCYPNRNDTCWSLDP
ELMHILSVSRNYALLLYAWEGWHNAVGIPLKPLYEEFTALSNEAHKQDGFSDTGDYWRSW
YESPTFVEDLEKLYHQLEPLYLNLHAYVRRALHRRYGDRYVNLRGPIPAHLLGDMWAQSW
DNIYDMVVPFPDKPNLDVTSTMLQKGWNATHMFRVAEEFFTSLGLLPMPPEFWAESMLEK
PTDGREVVCHASAWDFYNRKDFRIKQCTRVAMDQLSTVHHEMGHVQYYLQYKDQPVSLRQ
GANPGFHEAIGDVLALSVSTPSHLYKIGLLDHVVNDTESDINYLLKMALEKIAFLPFGYL
VDQWRWGVFSGRTPPSRYNFDWWYLRTKYQGICSPIARNETHFDAGAKFHVPHVTPYIRY
FVSFVLQFQFHEALCKEAGHQGPLHQCDIYQSTKAGDKLREVLQAGSSRPWQEVLKDAIG
SDTLDAQPLLNYFQPVSQWLQEQNQKNNEVLGWPEYQWQPPMPDNYPEDIALVTDEAEAS
KFMEEYDQRSKVVWNEYAEANWNYNTNITAEASKILLQKNIQMANHTLKYGTRARRFDVT
YFQNTTMKRMIYKIQDLERAALPVEELEEYNQILLDMETTYSVASVCHSNGTCLQLEPDL
TSLMATSQKYEELLWAWKSWRDKVGRSILPFFPKYVELSNKAARLNGYKDAGHSWRSPYE
MPTLEQDLEQLFQELQPLYLNLHAYVRRALHRHYGPQHINLEGPIPAHLLGNMWAQTWSN
IYDLVVPFPSAPNLDATEAMIKQGWTPRRMFEEANNFFTSLGLLPVPPEFWNKSMLEKPT
DGREVVCHASAWDFYNGKDFRIKQCTTVNMEDLVVAHHEMGHIQYFMQYKDLPVTFREGA
NPGFHEAIGDVLALSVSTPKHLHSINLLSSDGDSYEQDINFLMKIALDKIAFIPFSYLID
QWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVARSQGDFDPGAKFHIPANVPYIRYFV
SFIIQFQFHEALCQAAGHKGPLHKCDIYQSKEAGKRLAAAMQLGFSKPWPEAMELITGQP
NMSASAMMNYFKPLLDWLLTENARHGEKLGWPQYNWTPDSARSEGTFPGNSHVNFLGLNL
EEQQARVGQWVLLFLGVALLVATLGLTQRLFSLRHHRRSHRGPQFGSEVELRHS
NT seq 3945 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcgtcgggccaccctgagctggggccgcggccaccgctccagccactgccg
ctgccgctgctgatgttgttgttgctgctgccgccgtcgccacccagcgccctggctctc
gaccccgcgctggagcccggagactttcccgccgacgaggctggggcgcagctcttcgtg
cagagcttcaacccgaaagccgagcaggtgctgtaccagagcacagtcgccagctgggcg
cacgacactaacatcaccgaggagaatgcgcggcgccaggaagagtcagccctgctcaac
caggagtttgcagaggtctgggggcagaaggccaaggagctgtatgacccaatctggcag
aatttctctgacccgatactgcgaagggtcctcagtggtgtgcgcattctgggccctgcc
aacctgcccttggagaagcggcagcagtacaactctctgctaagcaacatgaacaggatc
tactccaccgtcaaggtctgctaccccaacagaaatgacacctgttggtccctggaccca
gagctcatgcatatcctgtctgtctcacgaaactacgccctgctgctatatgcctgggag
ggctggcacaatgccgtgggcatccccctgaagcccctgtatgaggagttcactgccctc
agcaatgaggcccacaagcaggatggcttctcagacaccggagactactggcgctcctgg
tacgagtcacccaccttcgtggaggacctggagaaactctaccatcagttagagcccctc
tacctgaacctccatgcctacgtccgccgcgcactgcaccgccgctatggggacagatat
gtcaacctccggggacccatccctgctcacctgctgggggacatgtgggcccagagctgg
gacaacatctacgacatggtggtgcctttccctgacaagcccaatctcgacgtcaccagt
actatgttacagaagggctggaatgctacacacatgttccgggtggcagaggagttcttc
acgtccctggggctcttgcccatgcctccggagttttgggcagagtccatgctggagaag
ccgacggacgggcgggaggtggtgtgccacgcgtccgcctgggacttctacaacagaaag
gacttcaggatcaagcagtgcacacgggtggctatggaccagctgtccacagtgcaccac
gagatgggccatgtacagtactacctgcagtacaaggaccagcctgtctccctgcgccaa
ggcgccaaccctggcttccatgaggccatcggggatgtgctggcgctctctgtctccact
ccttcacatctgtacaaaattggcctgctggaccacgtcgtcaatgacacagaaagcgac
atcaattacttgttaaagatggcgctggaaaaaattgccttcctgccctttggctacttg
gtagaccagtggcgttggggggtctttagtggacgtacccccccttcccgctataacttt
gactggtggtatcttcgaaccaagtatcagggcatctgttctccaattgcccgaaatgaa
acccactttgatgccggagctaagtttcacgtcccacatgtgacaccatacatcaggtac
tttgtgagttttgtcctgcagttccagttccatgaagccctgtgcaaggaggcaggccac
cagggcccactgcaccagtgtgacatctatcagtccaccaaggccggggacaaactccgg
gaggtgctacaggcaggctcctcacggccctggcaggaggtactcaaagatgcgatcggc
tcagataccctggacgctcagcctctgctcaactacttccagccagtcagtcagtggcta
caagagcagaaccagaagaacaacgaggtcctgggctggccggaatatcagtggcagcca
ccaatgcccgacaattacccggaagacattgctctggtgactgatgaggctgaggccagc
aagtttatggaagagtatgaccagagatccaaagtggtgtggaacgaatatgccgaggcc
aactggaactacaacacgaacatcaccgcagaggccagcaagatcctgctgcagaagaac
atacagatggcaaaccacaccttaaagtatggcacccgagccaggcggtttgatgtgacc
tactttcagaacaccaccatgaagcggatgatatacaagattcaggacctagagcgggca
gcgctgcctgtcgaggagctggaggagtacaaccagatcctgctggacatggaaaccacg
tacagcgtggcctctgtgtgccactccaacggcacttgtcttcagttagaacctgatctc
accagtctgatggccacgtcccagaaatatgaagaactcttatgggcatggaagagctgg
cgagataaggtgggaagatccattcttccttttttccccaaatatgtggaactctccaac
aaggctgcccggctcaatggctacaaagatgcagggcactcgtggagatctccgtatgag
atgccaaccctggagcaggacctggagcagctcttccaggagctgcagccgctgtacctg
aacctgcacgcctacgtgcgccgggccctgcaccgccactacggtccccagcacatcaac
ctggaaggccccattccagctcatctgctgggaaacatgtgggcgcaaacctggtccaat
atctatgacttggtggtgcccttcccttcagcccccaacctggatgccacggaggccatg
ataaagcagggctggacacccagaaggatgtttgaggaagcgaataatttctttacctcc
ctggggctgctgcctgtgccccccgagttctggaacaagtccatgctggagaagccgacc
gatgggcgggaggtggtgtgccacgcctccgcctgggacttctacaacggcaaggacttc
aggatcaagcagtgcaccaccgtgaacatggaggacctggtggtggcccaccacgaaatg
ggccacatccagtatttcatgcaatacaaggacttgcctgtgaccttccgggagggtgcc
aaccctggctttcacgaggccattggggacgtgctggccctgtccgtatctacccccaag
cacctacacagcatcaacctgctgagcagcgacggtgacagctatgaacaagacatcaac
tttctgatgaagatagcactcgacaagatcgcctttatccccttcagctacctcatcgac
cagtggcgctggagggtgtttgacggaagcatcaccaaggagaattacaaccaggagtgg
tggagcctcaggctgaagtaccagggcctctgccccccagtggccaggtctcaaggcgat
tttgacccaggggccaagttccacattcctgcaaatgtgccttatatcaggtacttcgtc
agcttcatcatccagttccagttccatgaggctctgtgtcaggccgctggccacaagggc
cccctgcacaaatgtgacatctaccagtccaaggaggcagggaagcgactggcggccgcc
atgcagctgggcttcagtaagccatggccggaagccatggagctgatcactgggcagccc
aatatgtctgcctcagccatgatgaactacttcaagccgctgctggactggctcctcact
gagaacgcgcggcatggagagaagctgggctggcctcagtacaactggacgccagactct
gctcgctcagaaggcacattcccgggcaacagccacgtcaacttcctgggcctgaacctg
gaggagcagcaggcccgcgtgggccagtgggtgctgcttttcctgggcgtcgccctgcta
gtggccaccttgggcctcacccagcggctcttcagccttcgccaccaccgccggtcccac
cgtgggccccagttcggctctgaggtggaactgagacactcctga

DBGET integrated database retrieval system