KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109449420Help
Entry
109449420         CDS       T04863                                 

Gene name
GAA
Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00052  Galactose metabolism
rss00500  Starch and sucrose metabolism
rss01100  Metabolic pathways
rss04142  Lysosome
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109449420 (GAA)
   00500 Starch and sucrose metabolism
    109449420 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    109449420 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:rss04147]
    109449420 (GAA)
Enzymes [BR:rss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     109449420 (GAA)
Exosome [BR:rss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   109449420 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109449420
NCBI-ProteinID: XP_019591221
LinkDB All DBs
Position
Unknown
AA seq 946 aa AA seqDB search
MDMKWPPCPRPLLGACALLSLATAALVGHVLLHNFMVVPRELHDFSQVPKEMNQAHQQRA
SGPGPQPSLGAAPTQCEVPPNSRFDCAPDKAITREQCEARGCCYVPARWRPRGPQMAQPW
CFFPPSYPSYKLENLTTTETGYTATLRRDTPTFFPKDVLTLRLDVLMETESRLHFTIRDP
ANRRYEVPLETPRVHSRAPSTLYSVEFSEEPFGVVVRRKLDGRVVLNTTVAPLLFAEQFL
QLSTSLPSPYVAGLAEHLGPLVLSTNWTKVTLWNRDVAPTSDVNLYGSHPFYLVLEDGGL
AHGVFLLNSNAMDVVLQPSPALSWRSTGGILDVYVLLGPEPKSVVRQYLDVVGYPFMPPY
WGLGFHLCRWGYSSTAITRQVVENMTRALFPLDVQWNDLDYMDARRDFTFNTDGFADFPA
MVQELHQGGRRYVMIVDPAISSSGPAGSYRPYDEGLRRGVFITNETGQPLIGKVWPGPTA
FPDFTNPEALDWWQDMVAEFHAQVPFDGMWIDMNEPSNFVKGSMDGCPDSDLENPPYVPG
VVGGTLRAATICASSHQFLSTHYNLHNLYGLTEALASHRALVKVRGTRPFVISRSTFAGH
GRYAGHWTGDVWSSWEQLSSSVPEVLLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGA
FYPFMRNHNDLHSLPQEPYRFSDSAQQAMRTALTLRYALLPHLYTLFHRAHTGGETVARP
LFLEFPEDPRTWTVDRQLLWGEALLITPVLEAGKVEVTGYFPTGTWYNLQTVPAEAFGSL
PPPPSAPFKSAIHSDGQWVTLPAPLDTINLHLRAGHIIPLQGPGLTTTESRKQPMALAVA
LTGSGEARGELFWDDGESLGVLERGAYMQVVFLARNNTIVNELLHVTSEGAGLQLRKVTV
LGVVTAPQQVVSNGIPVSNFTYSPHTQTLAIPVSLAMGEQFLISWS
NT seq 2841 nt NT seq  +upstreamnt  +downstreamnt
atggacatgaagtggccgccctgcccccgccccctgctgggggcctgtgccctcctctct
ttggccaccgccgccctcgtggggcatgtcctgctccacaatttcatggtggtcccccga
gagctgcatgacttctcccaagttcccaaggagatgaaccaagctcaccagcagagagcc
agcggcccagggccccagcccagcctgggagcagcgcccacacagtgtgaagtgcccccc
aacagccgctttgactgcgccccagacaaagccatcacccgcgagcagtgtgaggcccgg
ggctgctgctacgtgcctgcaagatggcgacctcggggccctcagatggcgcagccctgg
tgcttcttcccacccagctacccgagttacaagctggagaacctgactaccacagagacg
ggctacacggccaccctgcgccgagacaccccgaccttcttccccaaggacgtcctgacc
ttacggctggacgtgctgatggagaccgagagccgactccacttcacgatcagagatccc
gccaacaggcgctacgaggtgcccttggagaccccgcgtgtccacagccgggcgccgtcc
acactctacagcgtggagttctctgaggagccctttggtgtggtcgtgcgccggaagctg
gacggacgggtggtgctgaacaccacggtggccccgctgctcttcgccgagcagttcctg
cagctgtccacctccctgccgagcccgtacgtcgccggccttgccgagcacctcggcccg
ctagtgctcagcaccaactggaccaaggtcacgctctggaaccgggacgtggcccccacg
tccgacgtgaacctgtacgggtcccaccctttctacctggtgctggaggacggcgggttg
gctcacggggtcttcctcctgaacagcaacgccatggatgtggtcctgcagccgagccca
gccctcagctggcggtcaacgggcgggatcctggacgtgtatgtcttgctgggcccggag
cccaagagtgtggtgcggcagtacctggacgtcgtgggctacccgttcatgccgccgtac
tggggcctgggcttccacctgtgtcgctggggctactcgtccaccgccatcacccgccag
gtggtggagaacatgacccgggccctcttccccctggacgtccagtggaacgacctggac
tacatggacgccaggagggactttactttcaacacggacggctttgcagacttcccggcc
atggtgcaggagctccaccagggcggccggcgctacgtgatgatcgtggatcccgctatc
agcagctctggccccgctgggagctaccgaccctacgatgagggtctgcggaggggggtt
ttcatcaccaatgagaccgggcagccactgattgggaaggtgtggccgggacccactgcc
ttccccgacttcaccaaccccgaggcccttgactggtggcaggacatggtagccgagttc
catgcccaggtgcccttcgacggcatgtggattgacatgaatgagccatccaactttgtg
aagggctccatggacggctgccccgacagcgaccttgagaacccgccttatgtgccaggg
gtggttggcgggaccctgcgggcagccaccatctgtgcctccagccaccagttcctctcc
acacactacaacctgcacaacctgtacggcctgacggaagccttggcctcccacagggcc
ctggtgaaggttcgggggacgcgcccctttgtgatttcccgctcaaccttcgctggccac
ggccggtatgccggccactggacaggggacgtgtggagcagctgggagcagctgtcctcc
tccgtgccagaagtcctgctcttcaacctgctgggggtgccccttgtgggggccgacatc
tgcggcttcctgggcaacacctcggaggagctgtgcgtgcgctggacccagctgggggcc
ttctatcccttcatgcggaaccacaacgacctgcacagcctgcctcaggagccctacagg
ttcagtgattcggctcagcaagccatgaggacggccctcaccttgcgttatgcgctgctg
ccccacctctacacgctgttccaccgggcccacaccgggggcgagaccgtggcccggccc
ctcttcctggagttccctgaggacccccgcacctggaccgtggaccgccagctcctgtgg
ggggaggcccttctcatcacgccagtgctcgaggccgggaaggttgaagtgactggctac
ttccccaccggcacgtggtacaacctgcagacggtaccagcagaggcctttggcagcctc
ccgcctcccccttcagcaccctttaagtctgccatccacagtgatgggcagtgggtgacg
ctgccagcccctctggacaccatcaacctccacctccgggctgggcacatcatccctctg
cagggccccggcctcacaaccacagagtcccgcaagcagcccatggccctggccgtggcc
ctgacagggagcggggaggctcgcggggagctcttctgggacgacggggagagcctgggg
gtgctggagcgcggggcctacatgcaggtcgtcttcctggccaggaataacaccatcgtg
aacgagctgctgcatgtgaccagtgagggggctggcctgcagctgaggaaggtgacggtc
ctgggggtggtcacggccccccagcaggtcgtgtccaacggcattcctgtctccaacttc
acctacagcccccacacccagaccctggccatccctgtctcgctggcgatgggagagcag
tttctcatcagttggtcgtaa

DBGET integrated database retrieval system