KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109450625Help
Entry
109450625         CDS       T04863                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin G/H synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00590  Arachidonic acid metabolism
rss01100  Metabolic pathways
rss04064  NF-kappa B signaling pathway
rss04370  VEGF signaling pathway
rss04625  C-type lectin receptor signaling pathway
rss04657  IL-17 signaling pathway
rss04668  TNF signaling pathway
rss04723  Retrograde endocannabinoid signaling
rss04726  Serotonergic synapse
rss04913  Ovarian steroidogenesis
rss04921  Oxytocin signaling pathway
rss04923  Regulation of lipolysis in adipocytes
rss05140  Leishmaniasis
rss05163  Human cytomegalovirus infection
rss05165  Human papillomavirus infection
rss05167  Kaposi sarcoma-associated herpesvirus infection
rss05200  Pathways in cancer
rss05204  Chemical carcinogenesis
rss05206  MicroRNAs in cancer
rss05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    109450625 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    109450625 (PTGS2)
   04064 NF-kappa B signaling pathway
    109450625 (PTGS2)
   04668 TNF signaling pathway
    109450625 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109450625 (PTGS2)
   04657 IL-17 signaling pathway
    109450625 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    109450625 (PTGS2)
   04913 Ovarian steroidogenesis
    109450625 (PTGS2)
   04921 Oxytocin signaling pathway
    109450625 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    109450625 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    109450625 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    109450625 (PTGS2)
   05206 MicroRNAs in cancer
    109450625 (PTGS2)
   05204 Chemical carcinogenesis
    109450625 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    109450625 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    109450625 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    109450625 (PTGS2)
   05165 Human papillomavirus infection
    109450625 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    109450625 (PTGS2)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     109450625 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 109450625
NCBI-ProteinID: XP_019593684
LinkDB All DBs
Position
Unknown
AA seq 605 aa AA seqDB search
MLARALLLLYATLALSCAGNPCCSNPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEF
LTRIKLFLKPTPNTVHYILTHFKGVWNIVNNIPFLRNAIMKYVLTSRSHLIDSPPTYNAQ
YGYKSWEAFSNISYYTRALPPVADDCPTPMGVKGKKELPDSKLIVEKFLLRRTFVPDPQG
TNLMFAFFAQHFTHQFFKTDHKRGPAFTKGLGHGVDLNHIYGETLDRQHKLRLFKDGKMK
YQIIDGEMYPPTVKDTQAEMIYPPHVPEHLRFAVGQEVFGLVPGLMMYATIWLREHNRVC
DVLKQEHPEWDDERLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQY
QNRIAAEFNTLYHWHPLLPDTFQIEDQEYNHRQFLYNNSMLMEHGLTQFVESFSRQIAGR
VAGGRNLPAAIQHVAKASIDQSRQMKYQSLNEYRKRFLMKPYESFEELTGEKEMAAELEA
LYGDIDAMELYPALLVEKPRTDAIFGETMVELGAPFSLKGLMGNPICSPNYWKPSTFGGE
VGFKIINTASIQSLICNNVQGCPSTSFSVQDPEPTKTVTINASPSHSGLDDINPTVLLKG
RSTEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgcgccttgctgctgctctacgccaccctggcgctcagctgtgcaggaaat
ccttgctgttccaacccatgtcaaaaccgaggtgtatgcatgagtgttggatttgaccag
tataagtgtgactgtacccggacaggattctatggtgaaaactgtacaacacctgaattt
ctgacaagaataaaattattcctgaaacccactccaaacacagtgcactatatacttacc
cacttcaagggagtctggaacattgtcaataatattcccttcctgcgaaatgcaattatg
aagtatgtgttgacatccagatcacatttgattgacagcccgccaacctacaatgcacag
tatggctataaaagctgggaagccttttctaatatctcctattataccagagctcttcct
cctgtggctgacgactgtcccactcccatgggcgtgaaaggaaagaaagagcttcctgat
tcaaaattgattgtggaaaaatttcttctaaggagaacgtttgtccctgacccccagggc
acaaatttgatgtttgcgttctttgcccagcacttcacccatcagtttttcaagacagat
cacaagcgaggaccagctttcaccaaaggactggggcatggggtggatttaaatcatatt
tatggtgaaactttggatagacagcataaactgcgccttttcaaggatggaaaaatgaaa
tatcagataattgatggagagatgtatcctcccacagtcaaagatactcaggcggagatg
atctatccccctcatgtccctgaacacctgcggtttgctgtggggcaggaggtgtttggt
ctggtgccgggtctgatgatgtatgccacgatttggctccgagaacataacagagtgtgt
gatgtgcttaaacaggagcatccagaatgggatgacgagcggttgttccagacaagcagg
ctgatactgataggagaaaccattaagatcgtgatagaagactacgtacagcacttgagt
ggctatcacttcaaactgaagtttgacccagagctgcttttcaaccaacaattccagtac
caaaaccgcattgctgctgagtttaacacgctctaccactggcatcccctcctgcctgac
acctttcagattgaagaccaggagtacaaccatcgacagtttctctacaacaactctatg
ttaatggaacatgggcttacccagtttgttgaatcattcagcaggcaaattgctggcagg
gttgctggtggcaggaatctcccagctgcaatacaacacgtagcaaaggcctccatcgac
cagagcagacagatgaagtatcagtctctgaatgagtaccgcaaacgctttctgatgaag
ccctatgaatcatttgaagaacttacaggagagaaggaaatggctgcagagttagaagcc
ctctatggggacatcgatgccatggagctgtatcctgcccttttggtagaaaagccacgc
acagatgccatctttggtgagaccatggtagaacttggcgcacctttctccttgaaagga
cttatgggcaatcctatatgttctcctaactactggaaaccgagcacttttggtggagaa
gtaggttttaaaatcatcaacactgcctcaatccagtctctcatctgcaataacgtgcaa
ggctgtccttctacttcattcagtgttcaagacccagaacccaccaagacagtgaccatc
aatgcaagcccttcccactctggactggatgatattaaccctacagtactactgaaagga
cgttcaactgaactgtag

DBGET integrated database retrieval system