KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109451842Help
Entry
109451842         CDS       T04863                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle protein 23 homolog isoform X1
  KO
K03355  anaphase-promoting complex subunit 8
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04110  Cell cycle
rss04114  Oocyte meiosis
rss04120  Ubiquitin mediated proteolysis
rss04914  Progesterone-mediated oocyte maturation
rss05166  Human T-cell leukemia virus 1 infection
Module
rss_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:rss00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    109451842 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    109451842 (CDC23)
   04114 Oocyte meiosis
    109451842 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    109451842 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    109451842 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:rss04121]
    109451842 (CDC23)
   03036 Chromosome and associated proteins [BR:rss03036]
    109451842 (CDC23)
Ubiquitin system [BR:rss04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     109451842 (CDC23)
Chromosome and associated proteins [BR:rss03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    109451842 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 ANAPC3 TPR_16 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 109451842
NCBI-ProteinID: XP_019595934
LinkDB All DBs
Position
Unknown
AA seq 597 aa AA seqDB search
MAANPSVVPVALTAPVVQVLSASGDFSNLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGEIPSTEMPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgaacccctctgtagtcccggtggccctgacggctccggtggtacaggttttg
tcagcgagcggcgatttctcaaatttgcgagaaattaaaaagcagctgctactcatcgcc
ggccttacccgggagcgtggcctactgcacagtagcaaatggtccgcggagttggccttc
tcccttccggcgttgcctctggccgagctgcagccgcctccgcctattacagaggaggat
gcccaggatatggatgcttacaccctggccaaggcttactttgatgttaaagagtatgat
cgggcagcacatttcctgcatggatgcaatagcaagaaagcctatttcctgtacatgtat
tctagatatctgtctggagaaaagaagaaggacgatgaaacagttgatagcctaggccct
ctggaaaaaggacaagtaaaaaatgaggctcttagagaattgagagtagagctcagcaaa
aaacaccaggctcgggaacttgatggatttggcctttatctgtatggtgttgtgcttcga
aaactggacttggtgaaagaggccattgatgtgtttgtggaggctactcatgttttgcct
ttgcattggggagcctggctagaactctgtaacttgattacagacaaagagatgctgaag
ttcctgtctctgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatatcgac
aaagccctctctatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatctgagttgagttatctggct
cacaacctctgtgagattgataaataccgtgtagaaacgtgctgtgtaattggcaattat
tatagtttgcgttctcagcatgagaaagcagccttatatttccagagagccttgaaattg
aatcctcggtatcttggggcctggacactgatgggacatgagtacatggaaatgaagaac
acgtctgccgctattcaggcttatagacatgccattgaggtcaataagcgggactacaga
gcctggtatggcctcgggcagacctatgaaatccttaagatgccattttattgcctttat
tattacagacgagcccaccagcttcggcccaatgattctcgtatgctggttgctttagga
gaatgttatgaaaaactcaatcagctagtggaagccaaaaagtgttattggagagcttac
gctgtgggcgatgtggagaaaatggctctggtgaaactcgcaaagcttcatgaacagttg
actgagtcagaacaggctgcccaatgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtggaacacttggaggagagcactgctttccgctatctggcacagtactac
tttaagtgcaagctgtgggatgaagcttcaacttgtgcccaaaagtgttgtgcattcaat
gatacccgggaagaaggtaaggccttgctccggcaaatcctgcagcttcggaaccaaggc
gagattccttccaccgagatgcctgctccctttttcctcccggcttcactgtctgctaac
aacactcccacacgcagagtctctccactcaacctgtcttcagtcacaccatag

DBGET integrated database retrieval system