KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109452589Help
Entry
109452589         CDS       T04863                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00500  Starch and sucrose metabolism
rss01100  Metabolic pathways
rss04151  PI3K-Akt signaling pathway
rss04152  AMPK signaling pathway
rss04910  Insulin signaling pathway
rss04922  Glucagon signaling pathway
rss04931  Insulin resistance
Module
rss_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    109452589 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    109452589 (GYS1)
   04152 AMPK signaling pathway
    109452589 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    109452589 (GYS1)
   04922 Glucagon signaling pathway
    109452589 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    109452589 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rss01003]
    109452589 (GYS1)
Enzymes [BR:rss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     109452589 (GYS1)
Glycosyltransferases [BR:rss01003]
 Polysaccharide
  Storage polysaccharide
   109452589 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_4 Glyco_transf_5 Glycos_transf_1 Glyco_trans_4_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 109452589
NCBI-ProteinID: XP_019597207
LinkDB All DBs
Position
Unknown
AA seq 736 aa AA seqDB search
MPLSRTLSMSSLPGLEDWEDEFDLENTVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGD
NYYLVGPYTEQGVRTQVELLEPPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVILLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKPHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADIFLEALARLNYLLRVNGNEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTTFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHKALAKAFPEHFTYEPQETDAAQGYRYPRPASVPPSPSLSRHSSPPLSEDE
EDSQDRTPNEDTERYDEEEEAAKDRRNIRAPEWPRRSPCSSTGGSKRNSVDTAPSSSVST
PSEPLSPASSLGEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctcttagccgcactttgtctatgtcctcactgccaggactggaggattgggaagat
gaattcgacctggagaacacagtgctcttcgaggtggcctgggaggtggccaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacgggggatgagtggggcgac
aactactacctggtgggaccgtacacggagcagggcgtgaggacccaggtggaactgctc
gagcccccaactccagctctgaagaggacgctggactccatgaacagcaagggctgcaag
gtatatttcgggcgctggctgattgaggggggccccctcgtgatactcctggacgtgggg
gcctcagcctgggccctggagcgctggaagggggagctctgggacacctgcaacattggg
gtgccctggtatgaccgtgaagccaacgacgccgtcctttttggcttccttaccacctgg
ttcctgggtgagttcctggcccagagcgaggagaagccacatgtggttgcacacttccac
gaatggttggcgggcatcgggctctgcctgtgccgtgcccggcggctccctgtggctacg
atcttcaccacccatgccacgctgctggggcgatacctgtgtgccggtgctgtggacttc
tacaacaatctggagaatttcaatgtggacaaggaagctggtgagaggcaaatctatcac
cgttactgcatggagcgggcagcagcccactgcgctcatgtcttcactactgtgtcccag
atcactgccattgaggctcagcacctactcaagaggaaaccagatatcgtgacccccaat
ggactgaatgtgaagaagttctctgccatgcatgagttccagaacctccatgctcagagc
aaggcccgaatccaggagtttgtgcggggccatttttatgggcacctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctacgagttctccaacaagggggctgac
atcttcctggaggccttggcccggctcaactatctgctcagagtcaacggcaatgagcag
acagtagtcgccttcttcatcatgccagctcggaccaacaatttcaatgtggaaaccctc
aagggccaagccgtgcgcaagcagctttgggatacggccaacacagtgaaggagaagttc
gggaggaagctttatgaatccttgctagtggggagcctcccagacatgaacaagatgctg
gacaaggaggacttcactatgatgaagagagccatctttgccacacagcggcagtcattc
ccccctgtctgcacccacaatatgctggatgactcctcggaccctatcctgaccaccatc
cgccgaattggcctcttcaatagtagtgccgacagggtcaaggtgattttccacccagag
ttcctctcttccactagccccctgctccccgtggactatgaggagtttgtccgtggctgc
caccttggggtcttcccctcctactatgagccttggggctacacgccagctgagtgcacc
gttatgggcattcccagtatctccaccaacctctctggcttcggctgcttcatggaagaa
cacatcgcagacccctcagcttacggtatctatattctagaccggcggttccgcagtctg
gatgattcctgctcccagctcaccaccttcctctacagcttctgccagcagagccggcgg
cagcgcatcatccagcggaaccgtacagagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacaaggcgctggccaaggcctttccagagcat
ttcacctacgagccccaggaaactgatgcggcccagggctaccgctacccccggccggcc
tcggtgccaccatcgccttcattatctcgacactcaagccctcctctgagcgaggatgag
gaagattcccaggacaggacgccgaatgaagacaccgaacgctatgacgaagaagaggag
gccgccaaggaccggcgcaacatccgcgccccggagtggccgcgccgctccccctgctct
tccaccggcgggagcaagcgcaactctgtggatactgcgccctccagctcagtcagcact
cccagcgagcccctcagccctgccagctccctgggagaggagcgcaactga

DBGET integrated database retrieval system