KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109453873Help
Entry
109453873         CDS       T04863                                 

Gene name
DOT1L
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00310  Lysine degradation
rss05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109453873 (DOT1L)
 09160 Human Diseases
  09161 Cancers
   05202 Transcriptional misregulation in cancers
    109453873 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rss03036]
    109453873 (DOT1L)
Enzymes [BR:rss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109453873 (DOT1L)
Chromosome and associated proteins [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109453873 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 HALZ
Motif
Other DBs
NCBI-GeneID: 109453873
NCBI-ProteinID: XP_019599501
LinkDB All DBs
Position
Unknown
AA seq 1672 aa AA seqDB search
MENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQV
YNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVA
AATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIAN
TSVIFVNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVV
ELSPLKGSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTT
TPTKVPENKAAAPADTPVDSGAEEEKVGTTAIKKPSPSKARKKKLNKKGRKLAGRKRGRP
KKMSTANPERKPKKSPTALDLLRAQTASQTAAASPQDAYKSPHSPFYQLPPSVQRQPPDQ
LLLAPTPPALQKLLESFKIQYLQFLAYTKTPQYKASLQQLLDQEKEKNARLLGAAQQLFG
HCQAQKEEIKRLFQQKLDELGVKALTYSDLIQAQKEISAHNQQLREQTEQLDKDTRELRT
QSLQLLKARCEELKLDWSTLSLESLLKEKQALRSQISEKQRRCLELQISIVELEKSQRQQ
ELLQLKSCVPPDDAVPGHLRGKGGLGRELEAEPGRLHLELDCSKLSLPHFSSMSPELSMN
GHAASYELCSALSRPSSKQNTPQYLASPLDQEVVPCTPGHSSRPRLERLSGLALPDYTRL
SPAKLVLRRHLSQDHAASSKAATGELHPRAEHTKENGLPYQSPGLTNGIKLSPQDPRPLS
PVALQMTGEKGSEKGLKERAYASSGEAITSLPVSIPLSTVQPSKLPVSIPLASVVLPSRA
EKVRSTPSPVPQARESSSTLEKQMGANAHSSGSKGLALAPAGFSYTGSVAISGALAGSPV
PLAPGAEPPAFDESSSSGSLFATMGSRSSTPQHPPLLAQPRNSGPASPAHQLCASPRLGT
AQGPLPDASKGDLPSEAGFSDPESEAKRRAIFSISAGTSSTKQSPSNKHSPLPPGTRGDS
SQSHGQDSRKRGRRKRASAGTPSLSSGVSPKRRALPSVASLFTQSSGSPLNLNSMVNNIN
QPLEITAISSPESSLKSSPVPYQDNDQPPVLKKEKPLNQTNGAHYSPLTSDEEPGSEDEP
GSARIERKIATISLESKSPPKTLENGGGLVGRKPMPASEPVNSSKWKATFSPISDLGLAK
ATDTPLQASSALSQNSLFAFRPALEEPGSADTKLAAHPRKSFPGALSGAGGLSPSSNPPN
GFAFSGGLATDLSLHSFNDGASLSHKAPETASLGTPLSFPAPRGKEGGTEPSTFVNKRQL
DGLGGPKGEGGKSREADLGLPSCTPTDKASLTHIKAGKGRDREPDFKNGHNLFISATVPP
GGLLSGPGLATAASSAGSVAPSAQTHRPFLGTFAPGPQFSLGPVSLQANLGSSVLQSLFS
SVPAAAGLVHVSSAATRLTNSHAMGSFSSGVAGGAVGGVFNHAVPSASAHPFGASFGSGA
ACRSATLSLTPLQAVASTPASSFQAPPSMEPRLPLPPPAPPLGRPPAGPPALHAPPPPNA
ALPPVPALLPANSEPALLQNLAPLPANQAFLPASSAASLPPANASLSIKLASLPHKASRP
SFTVHHQPLPGLTLAQAAPVIPQASSTGPSAVWVSLGMPPPCAARLAGVKPR
NT seq 5019 nt NT seq  +upstreamnt  +downstreamnt
atggagaattacgtcctgatcgactacgacaccaaaagcttcgaaagcatgcagaggctt
tgtgacaagtacaaccgggccattgacagcatccaccagctgtggaagggcaccacgcag
cccatgaagctgaacacgcgaccgtccaacggactcctgcggcacatcctgcagcaggtg
tacaaccactcggtgacagaccctgagaagctcaacaactacgagcccttctccccggag
gtgtacggggagacctccttcgacctggtcgcacagatgattgacgagatcaagatgact
gaggatgacctatttgtggacctgggcagtggagtgggccaggtcgtgctgcaggttgcc
gcggccaccaactgcaaacatcactacggcgtcgagaaagccgacatcccagccaagtac
gcggagaccatggaccgagagttcaggaagtggatgaaatggtacggaaaaaagcatgca
gaatacacactggaaagaggcgatttcctctcggaagagtggagagagcggatcgccaac
acaagtgttatatttgtgaataactttgcctttggtcctgaggtggatcaccagctgaag
gagcgatttgcaaacatgaaggaaggtggcagaatcgtgtcctcgaagcccttcgcacct
ctgaacttcagaataaacagtagaaacttgagtgacatcggcaccatcatgcgcgtggtg
gagctgtcaccgctgaagggctcggtgtcatggacggggaagccagtgtcctactacctg
cacaccatcgaccgcaccatacttgaaaactatttttctagtctgaaaaatccaaaactc
agggaggaacaagaggcagctcggcgtcggcagcagcgagaaaacaagagtaacacgacc
acccccacgaaggtgcctgagaacaaggcagctgcacccgcggacacccctgtggattct
ggtgctgaggaagagaaagtggggacgactgccatcaagaagccatccccctccaaagcc
cggaaaaagaagctgaacaagaaggggcggaagctagccggccggaagcgcgggcgcccc
aagaagatgagcactgcaaaccctgagcgtaagcccaaaaagagcccgactgcactggac
ctgctgcgtgcccagactgcgtcccagacggctgccgcctcgccacaggatgcgtacaag
tcacctcacagcccgttttatcagctacctcccagcgtgcagcggcagccgcctgaccag
ctgctgctggcacccaccccgcctgcactgcagaagctgctagaatccttcaagattcag
tacctgcagttcctggcatacacgaagacccctcagtacaaggccagcctccagcagcta
ctggaccaggagaaggagaagaacgcccgcttgctgggcgctgcacagcagctgtttggc
cactgccaggcccagaaggaggagatcaagaggcttttccagcagaaactggatgagttg
ggagtgaaggccctgacctacagcgacctgatccaggcgcagaaggagatctcggctcac
aaccagcagctgcgggagcagacagagcagctggacaaggacacccgggagctgcgtacc
cagagcctccagttgctaaaggctcggtgtgaggagctgaagctggactggtctacactg
tccctggagagcctgctgaaggagaagcaggccctgaggagccagatctccgagaagcag
agacgctgcctggagctgcagatcagcattgtggagctggagaagagccaacggcagcag
gagctcctgcagctcaagtcctgtgtaccacccgacgacgctgtgcctggtcaccttcgc
gggaagggcggcttgggccgtgagctggaggcggaacccggccggctgcacctggagctg
gactgctccaagctctcactgccccacttcagtagcatgagcccggagctctccatgaat
ggccacgcagccagctatgagctctgcagtgcgctgagccggccctcgtccaagcagaac
accccccagtacctggcctcaccgctggaccaggaggttgtgccctgcacccctggccac
agcagccggccccgtctcgagaggctgtcgggcctggctctgcctgactacaccaggctc
tcacccgccaagctggtactcagacgacacctgagccaggaccatgcggccagcagcaag
gctgccaccggcgagctgcacccacgagccgagcataccaaggagaacggccttccatac
cagagcccaggcctcaccaatggcatcaagctgagccctcaggacccacggcccttgtcc
cccgtggccttacagatgacaggagagaagggcagcgagaagggtctgaaggagcgcgcc
tacgccagcagtggggaagccatcaccagcctgcctgtcagcatcccgctcagcaccgtg
cagcccagcaagctgcccgtcagcatccccctggccagcgtggtgctgcccagccgtgcc
gagaaggtgagaagcacccccagccctgtgccgcaggcacgagagtcatcatccacactt
gagaagcagatgggtgctaatgcccacagttctgggagcaaaggcctcgccctggccccc
gcaggcttctcctacaccggttcagtggccatcagcggggccctggcaggcagcccggtc
ccgcttgctcctggagccgagccccccgcctttgacgagtcctctagctcggggagcctc
ttcgccaccatgggctctcgcagctcgaccccacagcatcccccactgctggcacagccc
cggaactctggcccggcctcacctgcccaccagctgtgcgccagcccccggctgggcacc
gcccagggcccgctccctgatgccagcaaaggggaccttccctccgaggctggcttctca
gatccagagagtgaggccaagcggagggccatcttcagcatctcggccggcaccagcagc
accaaacagtcgccttccaacaagcatagccctctgcccccgggcacccgcggggacagc
agccagagtcacgggcaggacagccgtaagcggggcaggaggaagcgggcgtcggcaggg
acccccagcctgagctcgggcgtgtcccctaagcgtcgggcgctgccgtccgtcgccagc
ctcttcacgcagtcttcaggatcccctctcaacctcaactccatggtcaacaacatcaac
cagcctttggaaatcacggccatctcatcccccgagagctccctgaagagctctcctgtc
ccttaccaggacaacgaccagccacccgtgctcaagaaagagaagcccctcaaccagacc
aacggagcccactattccccactgacctcggatgaggagccgggctctgaggacgagccg
ggcagtgccagaattgagagaaaaattgccacgatctccttggaaagtaaatctcctccg
aaaaccttggaaaatggtggtggcctggtgggaagaaagccaatgcccgccagcgagcct
gtcaacagcagcaagtggaaggccaccttctcgcctatctccgacctcggcctggccaag
gccactgacaccccattgcaggccagctctgctctgagccagaactccctatttgctttc
cggcctgccctggaggagcccggctcggccgacaccaagctggctgcccaccccaggaag
agctttcccggtgccctgtcaggggccggtgggctgagcccaagcagcaaccctcccaac
ggcttcgccttcagcgggggcctggccactgacctcagtttacacagcttcaatgatggt
gcttctctctcccacaaggcccccgagacggccagcctgggcacccctttgagctttccc
gccccgcggggcaaggagggcggcacagagcccagcacctttgtgaacaagaggcagctg
gatggactgggaggcccgaagggcgaggggggcaagagcagggaggcagacctgggcctg
ccctcttgcacacccacagacaaggcctcgctgacacatatcaaggcgggcaagggccgg
gaccgcgagcctgacttcaagaatggccacaacctcttcatttccgccaccgtgcccccc
gggggcctcctcagtggcccgggccttgccacggcagcatcttcggcgggcagcgtggcc
ccctctgcccagacacaccggcccttcctgggcaccttcgcccccggcccgcagttctcc
ctgggccccgtgtccctgcaggccaacctgggctcatccgtgctgcagtctctgttcagc
tctgtgccggccgccgccggcctggtgcacgtctcgtccgctgcgaccagactgaccaac
tcacacgccatgggcagcttttcttccggggtggcaggcggcgcagttggaggtgtcttt
aaccacgcggtgccttccgcctccgctcatccgtttggagccagtttcggcagcggggct
gcgtgtcgcagcgccacgctgagcttaaccccgctgcaggcggtggccagcacccccgcc
tcttcctttcaggccccgccctccatggagccgaggctgcccctacccccgcctgctccg
cccctgggccggccccctgcggggccacccgccctccacgcgccccctcctcctaacgcc
gccttgcctcccgttcccgcgctgctccccgctaactctgagcccgcgctcctgcagaac
ctggcgcccctccctgctaaccaagctttcttacccgcctcctctgccgcctctctgcct
cctgctaacgcctctctgtccatcaagctcgcctccctcccgcacaaggcctcccgcccc
tccttcacggtgcaccaccagcccctgcctgggctgaccctggcccaggctgctcctgtg
atcccacaggccagctccacggggccatccgctgtgtgggtttcccttggcatgccgcct
ccttgtgccgcgcgccttgcgggggttaagccgcgataa

DBGET integrated database retrieval system