KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109454181Help
Entry
109454181         CDS       T04863                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00020  Citrate cycle (TCA cycle)
rss00190  Oxidative phosphorylation
rss01100  Metabolic pathways
rss01200  Carbon metabolism
rss04714  Thermogenesis
rss04932  Non-alcoholic fatty liver disease (NAFLD)
rss05010  Alzheimer disease
rss05012  Parkinson disease
rss05016  Huntington disease
Module
rss_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rss_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rss_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109454181 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109454181 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    109454181 (SDHA)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    109454181 (SDHA)
   05012 Parkinson disease
    109454181 (SDHA)
   05016 Huntington disease
    109454181 (SDHA)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109454181 (SDHA)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109454181 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 109454181
NCBI-ProteinID: XP_019600148
LinkDB All DBs
Position
Unknown
AA seq 664 aa AA seqDB search
MSGVRAVSRLLRARRLALTRPSPATPQTGTRSFHFAVDGNKRSSAKVSDSISTQYPVVDH
EFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEEDNWR
WHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQSLKF
GKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEDGECRGVIALCIE
DGSIHRIRARNTVVATGGYGRTYFSCTSAHTSTGDGTAMITRAGLPCQDLEFVQFHPTGI
YGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRGCGPE
KDHVYLQLHHLPPEQLAIRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNYKGQ
VLRHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCRPGDK
VAPIKANAGEESVMNLDKLRFADGSIRTSELRLNMQKTMQNHAAVFRVGSVLQEGCEKIS
HLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKDR
VDEYDYSKPVQGQQRKPFEQHWRKHTLSYVDLRTGKVSLEYRPVIDKTLNEADCATVPPA
IRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggggtccgggcggtgtcgcggctgctgcgggcccggcgcctggcgctgaccagg
ccgagcccagcaacaccgcagacaggtacccgcagttttcacttcgctgttgatggcaat
aagaggtcgtcggctaaagtttcagattcaatttccacgcagtacccagtagtggaccat
gagtttgatgccgtggtggtgggcgccggaggggcaggcttgcgagctgcgttcggcctc
tctgaggcgggctttaacacagcctgcgtgaccaagctgtttcccaccaggtcccacact
gtggcggcccagggagggatcaatgctgccctggggaacatggaggaggacaactggagg
tggcacttctatgacaccgtgaagggctccgactggctgggggaccaggacgccatccac
tacatgacagagcaggcccctgcctccgtggtggagctagagaattacggcatgcccttc
agcagaactgaagatgggaagatctaccagcgtgctttcggtggacagagcctcaagttt
ggaaaaggcgggcaggcccatcgctgctgctgtgtagccgaccgcactggccactcgctg
ttgcacacactgtatggacggtctctgcgatacgataccagctattttgtagagtacttt
gctttggatctcctgatggaagacggggagtgtcgtggtgtcatcgcactgtgcatagaa
gatggttccatccaccgcataagagcaaggaacactgttgtagctactgggggctacggg
cgcacctacttcagctgcacatcggcccacaccagcaccggtgacggcaccgccatgatt
accagggcaggccttccctgccaggacttggagttcgttcagttccaccccacaggcatc
tacggtgctggctgtctcatcacggaggggtgccgcggcgagggcggcattctcatcaac
agccagggcgagcgcttcatggagcggtacgcccctgtcgccaaggacctggcctcccga
gacgtcgtgtctcggtccatgactctggagatccgcgaaggcaggggctgtggtcctgag
aaggaccatgtgtacctgcagctgcaccacctgcccccagaacagctggccatccgcctg
cctggcatttcagagaccgccatgatctttgcgggcgtggacgtcaccaaggagccaatc
cctgtcctccctactgtgcactataacatgggtggcattcccaccaactacaaaggacag
gttcttaggcacgtgaatggccaggaccaagttgtgccgggcctatacgcctgtggggag
gccgcctgcgcctccgtgcacggcgccaaccgtctcggggccaactcgctcctggacctg
gtcgtctttggccgggcgtgcgccctgagcattgcagagtcctgcagacccggagataaa
gttgccccaattaaagcaaatgctggggaagaatctgtcatgaaccttgacaaattgaga
tttgctgacggaagcataagaacatcggaactacggctcaatatgcagaagaccatgcag
aaccacgcggccgtgttccgggtgggcagcgtgctgcaggaaggctgcgagaagatcagc
catctgtatggggacctcaagcacctgaagacgtttgatagagggatggtctggaacacc
gacctggtggagaccctggagctgcagaacctgatgctctgtgcacttcagaccatttat
ggggcggaggcccggaaggagtcacgtggggctcacgccagggaagactacaaggatcgg
gtggatgagtatgactactccaagcccgtccaggggcagcagcggaagccatttgagcag
cattggaggaaacacaccctctcctacgtcgacctcaggactgggaaggtctcgctggaa
tacagacccgtgatcgacaagactttgaatgaggctgactgcgccaccgtcccccccgcc
attcgctcctactga

DBGET integrated database retrieval system