KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109456030Help
Entry
109456030         CDS       T04863                                 

Gene name
SETDB2
Definition
(RefSeq) histone-lysine N-methyltransferase SETDB2 isoform X1
  KO
K18494  histone-lysine N-methyltransferase SETDB2 [EC:2.1.1.43]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    109456030 (SETDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:rss03036]
    109456030 (SETDB2)
Enzymes [BR:rss01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     109456030 (SETDB2)
Chromosome and associated proteins [BR:rss03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     109456030 (SETDB2)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    109456030 (SETDB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF3997
Motif
Other DBs
NCBI-GeneID: 109456030
NCBI-ProteinID: XP_019603573
LinkDB All DBs
Position
Unknown
AA seq 703 aa AA seqDB search
MGEKNGDAKTFWMQLEDDGKVDIMFEQVQNVLQSLKQKIKDGSATNKEYIQAMILVKEAT
ISNNSTLVKDHKPVTQNEQENKSSSLPSTSYEDSFPEDCTILSTKNKDILSLENKAADFR
EKESSLNLSYQSHDCSDACLMKKPQTFKGENPLQLPIKCHFQRRHAKTNSHSSALHVSYK
TPCGRSLRNMEEVFRYLLETECNFLFTDNFSFNTYVQLTRNYPKQEEIVSDVDISNGVES
VPISFCNEIDNRKLPYFKYRKTMWPRAYCLNSFSNMFTDSCDCSEGCIDITKCACLQMTA
RNAKTCPLSSDKIAFGYKHKRLQTHIPTGIYECSLLCKCNRRICQNRVVQHGPQVRLQVF
KTEKKGWGVRCLDDIDKGTFVCIYSGRLLSRSNTEKPDAVDENRKEGNIMKNVFSKKRKI
EVADCEVEVIPLELETNPRRAKTEECPPKFNKNPKEPVIEMKCNTISRIQCHSVIRSPKA
KIAIIQPNGKKMGFASSEYVTSEDDGFKPTQVHLNSKAKEIKMESSSNQVEDSEDNLLIE
SDVIDITKCREETPPEGSYNQATTSDNENAMKEFQVQILTPQEKNSPACQNQQVFCDKQL
PNETKTTSSDSLKISKGNVFLLDATKEGNVGRFLNHSCCPNLLVQNVFVETHDRNFPLVA
FFSNRYVKARTELTWDYGYEAGTMPEKEILCQCGVNKCRKKIL
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgggagaaaaaaatggtgatgcaaagactttctggatgcagctggaagatgatggaaaa
gtggacatcatgtttgagcaagtgcaaaatgtgctacagtcactgaaacaaaagatcaaa
gatgggtctgccacgaataaagaatatatccaagcaatgattctagtgaaggaagcaacc
ataagtaacaattcaacattggtaaaggatcataagcctgtgacccagaatgaacaggaa
aacaaatcaagttcattgccctctacgtcatatgaagactcctttccagaagactgtaca
attctatctacaaaaaataaggacattctttctctggaaaataaagctgcagactttaga
gaaaaagaatcatctctgaatttatcttaccaaagtcatgactgctctgatgcctgtcta
atgaaaaagccacaaaccttcaagggagaaaaccctctacagctaccaatcaaatgccac
ttccaaagacgacatgcgaagactaactctcactcttcagcgctccacgtgagttataaa
accccttgtggaaggagtctacgaaacatggaggaagtttttcgttacctgcttgagaca
gagtgtaactttttatttacagataacttttctttcaatacctatgttcagttgactcgg
aattacccaaagcaagaagaaattgtttctgatgtggatattagcaatggcgtggagtcg
gtgcccatttctttctgtaatgaaattgacaatagaaagcttccatactttaagtacaga
aagactatgtggccacgagcgtattgtctaaacagcttttccaacatgtttactgattca
tgtgactgttctgagggctgcatagacataacaaaatgtgcatgtcttcaaatgacggca
aggaatgctaagacttgccccttgtcaagtgataaaatagcctttggatataaacataaa
agactacagacacacatacctactggcatttatgaatgcagcctgttgtgcaagtgtaat
cgacgaatatgtcaaaaccgagttgtccagcatggacctcaagtgaggctgcaggtgttt
aaaactgagaagaaaggatggggagtgcgctgcctagatgacatcgacaaagggacattt
gtttgcatttattcaggaagattactaagcagatctaacaccgagaaacctgatgctgtt
gatgaaaatagaaaagaaggaaatattatgaaaaatgtgttttcaaaaaagagaaaaata
gaagttgcagattgtgaggttgaagttatcccattagaattggaaacaaatcctagaaga
gctaagactgaagagtgtccacctaagttcaataaaaatccaaaagagcctgttatagaa
atgaaatgtaacactatttcaagaattcagtgtcattcagttattagaagtccgaaagcc
aagatagccattattcaacccaatgggaaaaagatgggatttgcttcctcggaatatgtc
acttctgaagatgatggatttaaaccaacccaagtacatctgaactctaaagccaaggaa
ataaaaatggagtcaagctcaaaccaagttgaagattctgaagacaatctgctgattgaa
tcagatgtgatagatataactaaatgtagagaagaaactccaccagaaggcagctataac
caagcaaccacatcggacaatgagaatgctatgaaggagtttcaggttcaaatactaaca
ccccaagagaaaaactccccagcctgtcaaaaccagcaggtcttttgtgataaacagttg
ccaaatgaaaccaagactacttcatctgattctctgaagatcagtaaaggaaatgtgttt
ttattggatgccacaaaagaagggaatgtgggccgcttccttaatcatagttgttgtcca
aatcttttggtacagaatgtttttgtagaaacacatgacaggaattttccattggtggca
ttcttcagcaacaggtatgtgaaagcaagaacagaactaacatgggattatggttatgaa
gctgggactatgcctgagaaagaaattctctgtcaatgtggggttaataagtgtagaaaa
aaaatattataa

DBGET integrated database retrieval system