KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109456209Help
Entry
109456209         CDS       T04863                                 

Gene name
PFKM
Definition
(RefSeq) ATP-dependent 6-phosphofructokinase, muscle type
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00010  Glycolysis / Gluconeogenesis
rss00030  Pentose phosphate pathway
rss00051  Fructose and mannose metabolism
rss00052  Galactose metabolism
rss01100  Metabolic pathways
rss01200  Carbon metabolism
rss01230  Biosynthesis of amino acids
rss03018  RNA degradation
rss04152  AMPK signaling pathway
rss05230  Central carbon metabolism in cancer
Module
rss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    109456209 (PFKM)
   00030 Pentose phosphate pathway
    109456209 (PFKM)
   00051 Fructose and mannose metabolism
    109456209 (PFKM)
   00052 Galactose metabolism
    109456209 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    109456209 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    109456209 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    109456209 (PFKM)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:rss01009]
    109456209 (PFKM)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:rss03019]
    109456209 (PFKM)
Enzymes [BR:rss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     109456209 (PFKM)
Protein phosphatases and associated proteins [BR:rss01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     109456209 (PFKM)
Messenger RNA biogenesis [BR:rss03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     109456209 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 109456209
NCBI-ProteinID: XP_019603913
LinkDB All DBs
Position
Unknown
AA seq 780 aa AA seqDB search
MTHEEHHAARTLGVGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVD
GGNHIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAANNLVKLGITNLCVIGGDG
SLTGADTFRSEWSDLLNDLQKAGKITAEEAKKSSYLNIVGLVGSIDNDFCGTDMTIGTDS
ALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWE
DHLCRRLTETRTRGSRLNIIIVAEGAIDKHGKPITSEDIKNLVVKRLGYDTRVTVLGHVQ
RGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLMECVQMTKEVTK
AMNEKKFEEAMKLRGRSFMNNWEVYKLLAHVRPPVSKTGLHTVAVMNVGAPAAGMNAAVR
STVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWIGQGGSKLGTKRTLPKKSLEQ
ISANITKFNIQGLIIIGGFEAYTGGLELMEGRKQYDELCIPFVIIPATVSNNVPGSDFSV
GADTALNTICTTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAGADAAYIFEEPF
TIRDLQANVEHLVHKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGKGIFDSRKNVLG
HMQQGGSPTPFDRNFATKMGAKAMNWMTGKIKESYRNGRIFANTPDSGCVLGMRKRALVF
QPVTELKDQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEHVSRKRSGEAPV
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgacccatgaagagcaccatgcagccagaaccctgggggttggcaaagccatcgccgtc
ttaacctctggtggagatgcccaaggtatgaatgctgctgtcagggctgtggttcgagtt
ggtatttttactggtgcccgtgtcttctttgtccatgagggttatcaaggcctggtggat
ggtggaaaccacatccgtgaagccacctgggagagcgtttcaatgatgcttcagctggga
ggcacagtgattggaagtgcccggtgcaaggactttcgggaacgagagggacgactccga
gctgccaacaaccttgtgaagcttgggatcaccaatctgtgtgtcatcgggggtgacggc
agcctcactggggctgacaccttccgttctgagtggagtgacttgttgaatgacctccag
aaagcaggtaagatcacggctgaggaggctaagaagtccagctacctgaacatcgtgggc
ctggttggctcaattgacaatgacttttgtggcactgatatgaccattggcactgactct
gccctgcatcggataatagagattgtagatgccatcactactactgctcagagccaccag
cggacatttgtgctagaagtgatgggccggcactgtggatatctggcccttgtcacttct
ctctcctgtggcgccgactgggtttttattcctgaatgtccaccagatgatgactgggag
gaccacctttgtcgccggctcaccgagaccaggactcgtggttctcgtctcaacatcatc
attgtggctgagggtgcgattgacaagcatgggaaaccaatcacctctgaagacatcaag
aatctggtggtaaagcgtctgggatatgacacccgggtcactgtcttagggcatgtgcag
cggggtgggacaccatctgcctttgaccgaatcctgggcagcaggatgggtgtagaagca
gtgatggcacttttggaggggaccccagacaccccagcctgtgtggtgagcctctctggt
aaccaggctgtgcgcctgcctcttatggagtgtgtccaaatgaccaaagaggtgaccaag
gccatgaatgagaagaaatttgaggaagccatgaagctgagaggccggagcttcatgaac
aactgggaggtatacaagcttctggctcatgtcagacccccagtatctaagactggcttg
cacacagtggccgtgatgaatgtgggggcccctgccgcaggcatgaatgctgctgtccgc
tccactgtgagaattggcctcatccagggcaaccgagtcctggttgtgcatgacggcttc
gagggtttggccaagggtcagatcgaggaagctggctggagctatgttgggggctggatt
ggccaaggtggttctaaacttgggactaaaaggactctgcccaagaagagcttagaacag
atcagtgccaacatcacgaagtttaacattcaaggccttatcatcattgggggctttgag
gcttacacggggggcctggaactgatggagggcaggaagcagtacgatgagctctgcatc
ccatttgtcatcattcccgctacggtttccaacaacgtccctggctcggacttcagtgtg
ggggccgacacagcgcttaatacgatctgcacgacctgtgaccgcatcaagcagtcagca
gctggcaccaagcgtcgggtgtttatcattgaaactatgggtggttactgtggctacctg
gccaccatggcaggactggcagctggggccgatgctgcttacatttttgaggagcccttt
accattcgagacctgcaggcaaatgttgaacatctggtgcacaagatgaaaacaactgtg
aaaaggggcttggtgttaaggaatgagaagtgcaatgagaactacaccactgacttcatc
ttcaacctgtactctgaggaggggaagggcatctttgacagcaggaagaacgtgctcggc
cacatgcagcagggtgggagcccaactccatttgacaggaattttgccactaagatgggt
gccaaggctatgaactggatgactgggaaaatcaaagagagttaccgtaatgggcggatc
tttgccaatacgccagactcgggctgtgttctggggatgcgtaagagagccttggtattt
caaccagtgactgagctaaaggaccagacagattttgagcaccgcatccccaaggaacag
tggtggctgaagctgagacccatcctcaaaatcctagccaagtacgagatcgacttggat
acctcagagcacgctcacctggagcacgtcagtcggaagcggtctggggaagctcctgtc
taa

DBGET integrated database retrieval system