KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109456460Help
Entry
109456460         CDS       T04863                                 

Gene name
GALNT9
Definition
(RefSeq) LOW QUALITY PROTEIN: polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00512  Mucin type O-glycan biosynthesis
rss01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    109456460 (GALNT9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:rss01003]
    109456460 (GALNT9)
Enzymes [BR:rss01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     109456460 (GALNT9)
Glycosyltransferases [BR:rss01003]
 O-Glycan biosynthesis
  Mucin-type
   109456460 (GALNT9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3
Motif
Other DBs
NCBI-GeneID: 109456460
NCBI-ProteinID: XP_019604339
LinkDB All DBs
Position
Unknown
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIVLFSVYCRLQDRSEGLVQVVRGADRRGRSRLAKAGALLD
REAILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLQDDSQETEGKYEEYGY
NAQLSDRISLDRTIPDYRPKKCRQMTYSDDLPQVSVVFIFVNEALSVILRSVHSVVNHTP
PQLLKEVILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNSRREGLIRARLQGWKVATAP
VVGFFDAHVEFSTGWAEPALTRIREDGRRVVLPAIDNIKYDTFEVQQYASAAHGYNWGLW
CMYIIPPQDWLDRGDEAAPIRTPAMIGCSFVVDREYFGDIGLLDPGMEVYGGENIELGMR
VSVSWGLXAGXPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDGFKSHVYMAWNIP
MTNPGVDFGDVSERLALRQRLKCRSFQWYLENVYPEMRTYNSFGFWSXVRNSKASGYCLD
QGAEDDDRAILYPCHGMSSQLVRYSAEGLLQLGPLGSTSFLPDSKCLVDDGRARTPALKK
CEDVARPAQRLWDFTQSGPIVSRDTGRCLEVELSKDANFGLRLVVQRCSGQKWTIRNGIK
HGWH
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggccaggaagatcaaaactttgctgacggtgaatatcctggtgttcgtgggc
atcgtcctcttctccgtgtactgccgcctgcaggaccgctccgaggggctggtgcaggtg
gtgcgcggcgcggaccgccgtgggcgcagccggctggccaaggcgggcgcgctgctggac
cgcgaagccatcctgcagcgcctggaccacctggaggaggtggtctacaaccagctgaac
ggcctcgccaagcccatgggtctggtggaggggccgggaggcctgggccagggcggcatg
gcagccactctgcaggacgacagccaggagacagagggcaagtatgaagagtatggttac
aacgctcagctgagtgaccgcatctcgctggacagaaccatccccgactacaggcccaaa
aagtgcagacagatgacctactcggatgacctgccccaggtctctgtggtcttcatcttc
gtcaacgaggccctctccgtcatcctgcgctccgtccacagcgtggtcaaccacacgccc
ccccagctgctcaaagaggtcatcttggtggacgacaacagcgacaacgtggagctcaag
ttcaacttggaccagtacgtcaacaagaggtacccgggcctggtgaagatcgtgcggaac
agcaggcgagaaggcctgatccgggcgcggctgcagggctggaaggtggccacggccccc
gtcgtcggcttctttgacgcccacgtggagttcagcaccggctgggccgagcccgccctc
acgcgtatccgggaggacggccggcgtgtggtgctgccggccatcgacaacatcaagtac
gacacgttcgaggtgcagcagtacgccagcgctgcccacggctacaactggggcctctgg
tgcatgtacatcattcccccacaagactggctggaccgcggggacgaggccgcacccatc
agaacccccgccatgatcggctgctcgttcgtggtggaccgggagtatttcggggacatt
ggcctgctggacccaggcatggaggtgtacggtggcgagaacattgagctgggcatgagg
gtaagtgtgtcctggggtctgtgagcgggantgccctgctcccgcgtggcacacatcgag
cgcaccaagaagccctacaacaatgacatcgattactacgccaagcgcaacgccctgcgg
gcggccgaggtgtggatggacggcttcaagtcccacgtgtacatggcctggaatatcccc
atgaccaacccaggagtggacttcggggacgtgtctgagcggctggccctgcgccagagg
ctgaaatgtcgcagcttccagtggtacctggagaacgtgtaccctgagatgaggacttac
aactcctttggtttctggtcgtaggtgaggaacagcaaagccagtggctactgcttggac
cagggagcagaggacgacgaccgagcaatcctctacccgtgccacgggatgtcctcccag
ctggtgcgttacagcgcagagggtctgctgcagctgggcccgctgggctccacttccttc
ctgcccgactccaagtgcctggtggatgacggcagggcgcgcacacccgccctgaagaag
tgcgaggacgtggcccggccagcccagcggctgtgggacttcacccagagcggccccatc
gtgagccgtgacactggcaggtgcctggaggtggagctgtccaaggacgccaacttcggg
ctgcggctggtggtgcagaggtgctcggggcagaagtggaccatccgaaacgggatcaag
catgggtggcactga

DBGET integrated database retrieval system