KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109456988Help
Entry
109456988         CDS       T04863                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase [Mn], mitochondrial
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04068  FoxO signaling pathway
rss04146  Peroxisome
rss04211  Longevity regulating pathway
rss04213  Longevity regulating pathway - multiple species
rss05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:rss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    109456988 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    109456988 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    109456988 (SOD2)
   04213 Longevity regulating pathway - multiple species
    109456988 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    109456988 (SOD2)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     109456988 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 109456988
NCBI-ProteinID: XP_019605128
LinkDB All DBs
Position
Unknown
AA seq 222 aa AA seqDB search
MLCRAACSTSRKLVPALGSLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVN
NLNATEEKYGEALEKGDVTTQIALQPALKFNGGGHLNHSIFWTNLSPNGGGEPKGELLEA
IKRDFGSFAKLKEKLTTVSAGVQGSGWGWLGFNKEQGRLQIAACPNQDPLQGTTGLIPLL
GIDVWEHAYYLQYKNVRPDYLKAIWNVVNWENVTERYMACKK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgttgtgccgggcagcgtgcagtacgagccggaagctggtgccagctttggggtctctg
ggctccaggcagaagcacagcctccccgacctgccgtacgactatggcgccctggagcct
cacattaatgcccagatcatgcagctgcaccacagcaagcaccacgcggcctatgtgaac
aacctgaatgccaccgaggagaagtacggcgaggcgctggagaagggtgatgttacaact
cagatagctcttcagcctgcactgaagttcaatggtggaggccatctcaatcatagcatt
ttctggacaaacctgagccctaatggcggtggagaacccaaaggggaattgctggaagcc
atcaaacgtgactttggctccttcgccaaattgaaggagaagctgaccactgtatctgct
ggtgttcaaggctcaggttggggctggcttggcttcaataaggagcagggacgcttacag
attgctgcctgtcctaaccaggatcccctgcagggcacaacaggtcttattccactgctg
ggaattgatgtgtgggagcatgcttattacctgcagtataaaaatgtcagacctgattac
ctaaaagctatttggaatgtagtcaactgggagaatgtaactgaaaggtacatggcttgc
aaaaagtaa

DBGET integrated database retrieval system