KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109457159Help
Entry
109457159         CDS       T04863                                 

Definition
(RefSeq) probable maltase-glucoamylase 2
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00052  Galactose metabolism
rss00500  Starch and sucrose metabolism
rss01100  Metabolic pathways
rss04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109457159
   00500 Starch and sucrose metabolism
    109457159
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109457159
Enzymes [BR:rss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109457159
    3.2.1.20  alpha-glucosidase
     109457159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 109457159
NCBI-ProteinID: XP_019605399
LinkDB All DBs
Position
Unknown
AA seq 2363 aa AA seqDB search
MARNLSVLEVLLIIFLLIVLAVDVFLMFLVFENPSDDPFIPQCSEIPESERIDCVAGQVV
TEEVCRWQYKCCWKAVPNIDVPRCFFPKNWGYEVRNGLKNTSTGFTAQLERVPTPSLFGN
DVVDALFTAEYQTSSRFRFKITDRNNIRYEVPHENINLFNGTADTSNLNYHINVTEKPFS
IKIIRTSSKRVLLDTSIGPLQFAQQYLQLSFHLPSANVYGLGEHVHQQYRHSLAWKTWPI
FTRNAAPTQSMINLYGAHTFFLCLEDTSGSSFGVFLMNSNAMEVTLQPAPAITYRTTGGI
LDFYVFLGNTPEQVVQEYLELIGRPFLPSYWNLGFQLSRRGYGNLEGLGEVVNRTLKAGI
PYDVQYSDVDYMDEKKAFTINTKDYKGLPSFAKSLQERGLKYVIIMHPGISSDSGNKTYE
NGSKKRVWIFGENGFYMEQGYCPIVVFPDYTNPVCTEWWTEEFKMFHKTLEFDGVWIDMD
EVSNFYPNSDHRCAKNSLNYPPFTPRILDRMLFAGTLCMDAEFYWSFHYDVHSLYGYLMA
RATDSALKQIFHNKRNFIVSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPSILEFNLFGI
PMVGANICGYSLNVTEELCRRWMQLGAFYPLSRNHNGPGFRDQDPAAFGENSQLLISSRH
YLNIRYTLLPYLYTLFYRAHAYGETVARPLVHEFYQDPATWEVHEQFLWGPGLLITPVLY
EGVDRVKAYIPDAIWYDYETQVAVQWRKQLVEMLLPPDKIGLHLRGGYIFPTQQPNTTTE
TSRKNSLGLIIALDYKREAKGELYWDDGVSADAVTEGKYILYNFSVTSNHLQAKTIRNNY
MDPDNLMFTDIIILGMDKQPTNFSVVVEDVSTTISNVYYNASSKVVRITDLKKLALGKNF
SIAWHLLVSDLEKFNCYPEEPTASEKICSQRGCLWEHTTVPGVPTCFYDTVPKYAVSNIQ
YLPTGITTDLTHLTASESTRATSAPRDTQPPSAAKAAAASPLSAETSFLTLRVIYHTENM
LQFKIYDPTNKRYEVPVPLNTPRSPVGSPENRLYDVRIQTNPFGIQIRRKSSDTVIWDSQ
LPGFTFNDTFLSISTRLPSQNIYGFGETEHTTFRRNISWNTWGMFARDEPPGYKKNSYGV
HPYYMALEEDGSAHGVLLLNSNAMDVTFQPTPALTYRTTGGILDFYMVLGPTPELVTQQY
TELIGRPAMIPYWALGFQLSRYGYQNDTEISNLYDDMMAAQIPYDVQHVDIDYMDRKLDF
TLSTHFQNLGLLMERMKKNGMRFILILDPAISGNETQYLPFTRGRENNVFITWPNTRDIV
WGKVWPDLPNMDVDGSLDHETQVKLYRAHVAFPDFLRNSTAAWWKTEIKELYANPREPAK
SLKFDGLWIDMNEPSNFVDGSVRGCSDETLNKPLYMPYLESRAKGLSSKTLCMESEQILP
DGSPVRHYDVHSLYGWSQTRPTYEAVQEVTGKRGIVITRSTFPSSGRWGGHWLGDNTAAW
DQLKKSIIGMMEFSLFGISYTGADICGFFGDAEYEMCLRWMQLGAFYPFSRNHNSIGTRR
QDPVAWNSTFEKYSRDVLQIRYTLLPYLYTLMHRAHAEGSTVVRPLFHEFSDDKTTWDID
NQFMLGSAILISPVLQTNTFEILAYFPRAHWYDYSTELGNVSTGEWRRLEAPLDRINLHI
RGGYILPWQEPAMNTQSSRQKFMGLIVALDDNETAEGQMFWDDGESIDTYENGNYFLAKF
TAAQNTLQIQTIHNKYLSDSNPLKVGYIKIWGLLSPYVTRVIVTYDNMQITDVYFENDPN
KQTLTIQLTNKIISLEKLSEVTWIYGGPAISTTLMTSSLPTPTTSTFTTTSETNTASSTT
ISPTIASTSTAFPFTTTPFPTSAIGVTPTTTVPNITTPSHTNSTSGSTYATLPITTSLVP
TTVTDTSTATAVLITTTLFPTEGETSSTANTVPGTTPSLANSLTTGSTTVPFNSTYTTFA
VTSGTGTPVSTTQGPMPFPTTATDTTQLTTTHPATAATQALNHTTLISTNFPNPGTINTT
LAGTASTSMDPVTTNVLNITTAGNTKTTTGITTVSTITNATSMQMTTQVISTLRPIGTSG
ATTTDNVSPAAPTGIITTMYPPDIPTHALNTTSMSTESTTNANITNMVTGVTNISTPTRH
SPTTVDVNVTTIPIVNTVSTTPDTIISSTEDFTTPSHIKTTEIEPTPEVTRNATTAYTTT
NITTSIFSTKTTKSLTTSDTVLTNTYIPSTTANATTNTTRTRGHVVNITDVAGTSRVPGG
TTHASLPNTTTESNTLTSALLVTATHHMVTNSTANYLPMIATNATTDTTSITMHALSTTT
PDRTIDASATASTSIANTTSTAP
NT seq 7092 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaatctcagtgtattggaagtccttctgatcatcttcttgctaattgtcttg
gccgtagacgtcttcttgatgtttctggtgttcgagaatccttcagatgatccatttatt
ccccagtgctcagagatccccgaatcagaaaggatagactgcgtggctggccaggtggtg
acagaggaagtctgcagatggcaatataagtgctgctggaaggctgtaccaaatattgat
gtccctaggtgcttcttccccaagaactggggctatgaagtcaggaatgggcttaaaaat
acaagcacagggtttactgcccagttggaaagggtgccaaccccatctctgtttggaaat
gatgtcgtggatgccctcttcacagctgaatatcagacatccagtcgttttcgttttaag
atcactgatcgcaataacatacgctatgaagtcccccatgaaaatatcaatctgttcaat
gggacggctgatacctccaatttgaactatcacatcaatgtcactgagaaacccttcagc
atcaaaataataaggacaagcagcaaaagagtcttgttggacacgagcatcgggcccctc
cagttcgcccagcagtacctgcagctgtctttccacctgcccagtgccaacgtgtatggg
ctgggagaacacgtgcaccagcagtaccgccacagcctggcctggaagacgtggcccatc
ttcacacgcaacgccgcccccacccagagcatgattaatctgtacggagctcacacgttc
ttcctgtgccttgaagacaccagtggctcgtcttttggggttttcctgatgaacagtaat
gcgatggaggtcacccttcagcctgcgcctgcaatcacttaccgcactaccgggggcatt
cttgacttttatgtgttcctgggaaatactccagagcaagtggttcaggaatacctggag
ctcattggacgaccattcctgccttcttactggaatcttggattccagcttagtcgcagg
ggttacgggaacctcgagggattgggagaggttgtaaaccgaactcttaaagctgggatc
ccatatgatgttcagtactctgacgtagactacatggatgaaaagaaggctttcactatt
aacacaaaggattataaaggtctcccaagttttgccaagagcttacaggaacgtggacta
aaatatgtcattattatgcatcctggcatttcaagtgattctgggaataaaacctatgag
aatggaagtaaaaagagagtatggatcttcggggaaaatggtttttacatggagcagggt
tattgccccattgttgtctttcctgattacacgaatccagtctgtactgagtggtggaca
gaagagttcaaaatgtttcataaaactctggagtttgatggagtgtggattgacatggat
gaagtatcgaacttttacccaaattctgatcatcgatgtgcaaaaaacagtttgaactat
cctcctttcactcctcgaattctggaccgcatgctttttgcaggaaccctctgcatggat
gccgagttttattggagctttcattatgacgtccacagcttgtatggctacttgatggca
agagccacagactcggccttgaagcagatcttccacaataagaggaacttcatcgtatcc
cgttctacttttgctggatctggcaaatttgctgctcattggttgggggacaacgcggcc
acctgggatgatctccgatggtccatccctagtatccttgagttcaatctgtttggcatc
cccatggttggtgccaacatctgtggttattcactaaatgtcacagaggagctctgcaga
agatggatgcagcttggagcattttatccactatcaaggaatcacaatgggcctgggttc
agggaccaggaccctgctgcctttggtgaaaactctcagctgctgatttcctccagacat
tatctgaacatccgctacaccctgctgccctatctctacacccttttctaccgcgcccat
gcctatggcgagactgtagcgaggcctctggtccatgagttctaccaggacccggctacc
tgggaggtgcacgagcagttcttatgggggcctggactcctcatcacgcctgttctttat
gaaggtgtggaccgcgtgaaagcatacatacccgacgccatctggtacgactatgagaca
caagtagccgtccaatggaggaaacaattggtggagatgctactgccgcctgataagata
ggacttcaccttcgagggggctacatatttcccacccagcagccaaacacaaccacagag
acaagtcggaagaattccctgggactcattattgccttggactataagagagaagcaaag
ggcgagctgtactgggatgacggtgtgtctgcagatgctgtcactgaagggaaatatatt
ctgtacaatttttctgtcacctctaaccatctacaggcaaaaactatacgtaataattat
atggaccctgacaacctcatgtttacagatatcataatcttgggaatggacaagcaacct
accaactttagcgtcgtagttgaggatgttagcaccaccatttcaaacgtttactacaat
gcttcatcgaaggtggtgagaatcactgatctcaagaaactggccctgggaaaaaatttc
tccattgcgtggcatcttctggtcagtgacctggagaagttcaactgctaccccgaggag
cccacggcctctgagaagatttgcagccagcggggatgcctttgggagcacacgaccgtt
cctggcgtacccacctgtttctatgacaccgtccctaagtatgctgtcagtaacattcag
tatttgcccactggcatcaccacagaccttacccacctgacggcctctgagtcaacacga
gccacatcagcaccacgggacacacaacccccgtccgcagcaaaggcggctgccgccagt
cctctctctgcggaaaccagcttccttaccctccgggtgatctatcacacagaaaacatg
ctgcagttcaagatctatgatcccactaataaaaggtatgaggtgccagtgcctctgaac
acccctcgctctcctgttggctcccctgaaaaccgtctgtatgatgtcaggattcagacc
aatcctttcgggatccagattcgacgaaaaagctccgacactgtgatttgggactcgcag
ctccccggcttcaccttcaacgacacgttcctttccatttctactcgcctcccctctcag
aacatctatggctttggggaaactgagcacacgactttccgaagaaacatcagctggaac
acgtggggaatgtttgctcgagatgagccaccagggtacaagaagaattcctatggcgtc
cacccctactacatggcgctggaggaagatggcagcgcccatggggtgctcctgctaaac
agcaatgccatggatgtgacattccagcccacacctgccctcacataccgcaccacagga
gggattttggacttttatatggttttggggccaacccccgagcttgtaactcagcaatac
accgagttgattggtcggccagcaatgattccgtactgggccttgggattccagctgagt
cgctatggataccagaatgatactgaaatctccaatttgtacgatgacatgatggcagcc
cagattccctatgatgtgcagcacgtggacatcgattacatggaccggaagctggacttc
accctcagcacccacttccaaaacctcggtctcctgatggagcgaatgaagaaaaatggc
atgaggtttatcctcattctggacccagccatttctggcaacgagacccagtacctccct
ttcaccagagggcgggagaacaatgtgttcatcacgtggcccaacacccgtgatattgtc
tggggaaaggtttggccagatctacccaacatggatgtggatggatcccttgaccatgaa
actcaggttaagctctacagagcccacgttgctttccctgacttcttgcgtaatagcaca
gctgcgtggtggaagacggaaatcaaagagctgtacgcaaaccctcgagagccagcgaag
agcttgaagtttgatggattatggatcgatatgaatgagccatcaaacttcgtggatgga
tctgtcaggggctgcagtgatgaaactcttaataagccactctatatgccatatttggag
tccagagccaagggcctgagcagcaaaaccctgtgcatggagagtgagcagattctgcca
gacggttccccagtgcgacactatgacgtgcacagcctgtacgggtggtcccagaccaga
cccacctacgaagctgtgcaggaggtgacaggaaaacgagggatcgtcatcacccgctcc
acgttcccctcttccggccgctggggaggccactggctgggagacaacacggccgcgtgg
gaccagctaaagaagtccatcattggcatgatggagttcagtctctttggaatatcttat
acaggagcagatatttgtgggttctttggagatgctgaatatgagatgtgtcttcgctgg
atgcaactgggggccttttacccattttccaggaaccacaacagcatcgggacacggaga
caagaccctgtggcctggaactcgacctttgagaagtactcgagagacgtcttgcagatc
agatacaccctgctgccgtacctctacacgctgatgcacagagctcatgccgagggcagc
actgtcgtccgacccctttttcatgagtttagcgatgacaagaccacgtgggatatagat
aatcagttcatgctgggctctgccatcttgattagccctgtgctgcaaacgaacactttc
gagatcctcgcttattttcccagagcccattggtatgactatagcacggaattgggcaat
gtgtcgacaggggagtggagacgcctggaggcccccctggaccgcatcaaccttcacatc
agaggaggctacatcctgccttggcaggagcctgccatgaacactcagtccagtcgacaa
aaatttatgggattaattgttgctttggatgacaatgaaacagctgaaggccagatgttc
tgggatgatggagaaagcatcgatacctatgaaaatggcaactacttcttggcaaaattt
acagcagctcagaacacactgcaaatccagaccatccacaataagtatttgagtgactcg
aatcccctgaaagttgggtatattaaaatctggggactactctctccttatgtgacacga
gtcatcgttacctatgacaacatgcaaatcacggacgtgtatttcgaaaatgaccccaac
aaacagacactaactatacaattgactaacaagattatcagcctggaaaagttaagtgag
gttacatggatttacggtggtcctgcaatttctactacacttatgacgagttcgctaccg
actcctacaacttctacatttactaccacttctgagactaatactgctagttctactact
ataagtcctaccattgccagcactagtactgcctttccattcacaaccactccattccca
acaagtgctataggagttacaccgactactactgttcctaatattacgactccttcccat
acaaattctacttctggtagcacttatgctactcttcctatcacaacctctcttgtccca
acaactgtgactgacactagcactgctactgctgttcttataaccactactcttttccca
acagaaggtgagactagtagcactgctaatactgttccaggtacaactccttctcttgca
aacagcctcactaccggcagcacaactgttccctttaactccacatataccacgtttgct
gtaacaagtggtacaggcacaccagtctctactacccaaggccctatgccatttcccact
actgccacagacaccacacagctgactactacccaccctgctactgctgcgacacaggcc
ctaaaccacacaacattaatttccactaattttcctaacccaggcaccatcaacactact
ttggcaggcactgcatccactagcatggatccagttactacaaatgttttaaatattacc
actgcaggaaacacaaaaacaactacaggcatcactacagtttctacgattacaaatgct
acttctatgcaaatgactactcaggtcatttcaactctacgtcctatagggacttctggt
gccaccaccacagataatgtatctccagcggcacctactggaatcattaccactatgtat
cctccagatatccctactcatgctttaaataccacatccatgagcactgaaagcaccacg
aatgcaaatattactaatatggtaactggtgttactaacataagtactcccactagacac
agtccaacaactgttgatgttaacgttacaactattcctattgtgaatactgtttctact
actccagacacaataatttccagtactgaagactttaccactccctcacatataaaaact
acagaaattgaacctactcctgaagtaactaggaatgccacaactgcatatactaccacc
aatatcactacaagtattttcagcacaaaaactacaaagtccttgactacttctgacaca
gtccttacaaacacttacattcctagtaccacagcgaatgccaccaccaatactacaagg
actagagggcatgttgtaaatattactgatgtggctggcaccagccgtgttccaggtgga
acgacacatgcttctcttccaaataccacaacagaatcaaacacattaacgtctgctctt
ctagtgaccgctactcaccatatggtaacaaattctacggccaattatttacctatgatt
gcaactaatgctaccacagatactacgagtattaccatgcatgctttaagtactaccact
cctgacagaacaatagatgcttctgctactgcatctacttctattgcaaataccacaagt
actgctccctga

DBGET integrated database retrieval system