KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109457183Help
Entry
109457183         CDS       T04863                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00052  Galactose metabolism
rss00500  Starch and sucrose metabolism
rss01100  Metabolic pathways
rss04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109457183 (MGAM)
   00500 Starch and sucrose metabolism
    109457183 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    109457183 (MGAM)
Enzymes [BR:rss01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109457183 (MGAM)
    3.2.1.20  alpha-glucosidase
     109457183 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110 Abhydro_lipase
Motif
Other DBs
NCBI-GeneID: 109457183
NCBI-ProteinID: XP_019605431
LinkDB All DBs
Position
Unknown
AA seq 1819 aa AA seqDB search
MARKKLKDFTSLELMLSALLLAVFIITIPLFVLSAKESLESKDLGTIPDSTECPVLNESE
RINCIPDQPPTKATCDQRGCCWKPQGTISVPWCYYSKSHGYQVEGNLVNTRAGFTAQLKR
LPSPSLFGNDVDNVLLTAEYQTSNRFHFKLTDPNKVRYEVPHEHVQSFKGNAASPLTYEV
EVSPQPFSIKVKRRGNTRVLLDTSIGPLLFADQFLQLSMRLPSANVYGLGEHVHRQYRHD
MNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLMNSNAMDVVLQPTPAI
TYRTTGGVLDFYVFLGNTPEQVVQEYLELIGRPAMPAYWALGFHLSRYDYESLDKLKQVV
ERNRAAQLPYDVQHADIDYMDKRRDFTYNPVEFKGFPEFAEELHNNGQKLVIIVDPAISN
TSSPSDPYGPYDRGSDMKIWVNAPDGVTPLIGEVWPGKTVFPDYTNPRCAVWWAEEFKLF
HNQVKFDGIWIDMNEVSNFVDGSVSGCSTSSLNYPPFTPRVLDGYLFSKTLCMDAVQHWG
KQYDVHNLYGYSMAIATAEAVKTVFPDKRSFIVTRSTFAGSGKFAAHWLGDNAATWDDLR
WSIPGMLEFNLFGVPMVGPDICGYALDAPEELCRRWMQLGAFYPFSRNHNGQGYKAQDPA
SFGADSLLLNSSRHYLTIRYTLLPYLYTLFYRAHRWGETVARPLLHEFYGDSSTWDVHQQ
FLWGPGLLITPVLNEGAEKVMAYMPDAVWYNYETGGRVRWRKQKVEMDLPGDKIGLHLRG
GCIFPIQQPATTTVASRRNPLGLIIALDENKEAKGELFWDDGETKDTVANKVYLLCEFSV
TQNRLEVKILQSTYKDPNNLVFKEIKILGTQEPKNVIVKHNNVQSQVSPNVTYDSNLQVA
VITGLDLVLGEAYTVEWDLTIRDADKIDCYPDEKGASAESCAARGCAWEESSSPGVPFCY
FTNDLYSVSDIQYDSHGATAVLSLKSPVYANSLPSTPVNTLHLKVTYHKDEMLQFKIYDP
NNSRYEVPVPLNLPGAPSSTFESRLYDVLITNPFGIAVRRKSTGTVIWDSQLLGFTFNDM
FIRISTRLPSQYVYGFGETEHTAYRRDLNWHTWGMFSRDQPPGYKKNSYGVHPYYMALEE
DGSAHGVLLLNSNAMDVTFQPMPALTYRTTGGILDFYLFLGPTPELVTQQYTEMIGRPVM
VPYWSLGFQLCRYGYRNDAEIASLYDEMVAAQIPYDVQYSDIDYMERQLDFTLSPNFTGF
PALITRMKKDGMRVILILDPAISGNETDTYLAFERGVKDNVFIKDPTSGDILWGKVWPDL
PNIVINSSLDWDSQVEQYRAYVAFPDFFRNSTATWWKRELQELYTNPREPEKSLKFDGMW
IDMNEPSSFVNGAVPPGCKNATLNHPPYMPHLESRDRGLSSKTLCMEGEQILPDGSPVRH
YDVHNLYGWSQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDNTAAWDQLKKSI
IGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFARNHNTIGTRRQDPVSWD
DAFVSISRSVLQTRYTLLPYLYTLMHLAYTEGRTVVRPLLHEFVSNRVTWDIDRQFLLGP
AFLVSPVLEPNARNVTAYFPRARWYDYYTGEDIKVRGEWTSLPAPLDHINLHVRGGFILP
WQEPAQNTHLSRQKFVGLKVALDDNGTAEGWLFWDDGQSIGTYEKGLYYLARFSASQNTV
ESHIIFNKYITDTNPLKLGYIDIWGVDSPSISNVSISVSGTVVTPTFTYIATAQVLKIEM
TSKNISLHNFISLTWRSTQ
NT seq 5460 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaagatttcactagtttggagcttatgctcagtgctcttctg
ctggctgtgtttatcatcactattcctctctttgtgctttcagccaaagagtctttggaa
tctaaagatctggggaccattcctgattccactgagtgcccagtgctaaatgaatcggag
cggataaactgcatccctgaccagccgcctacaaaggccacatgcgatcagcgtggttgc
tgctggaaacctcaggggaccataagcgtgccctggtgctactattccaagagtcatggc
tatcaagtggagggcaacctcgtcaacaccagggcaggattcacagcccagttgaaaagg
ttgccgtctccatccctatttggaaatgatgtagacaacgtccttctcacagcggaatac
cagacatccaatcgtttccactttaagttaactgacccaaacaaagtcaggtacgaagtg
ccccatgagcatgtccaatccttcaaaggaaatgctgcttctcccttgacctatgaagtt
gaggtttccccacagccatttagcatcaaagtgaagagaagaggcaacactcgtgtcctg
ttggatacgagcatcgggcccctcctgtttgccgatcagttcctgcagctctccatgcga
ctgccgagtgctaacgtgtacggtctgggagaacacgtgcaccgccagtaccgccatgat
atgaactggaagacctggcccatatttgccagggacacaacccccaatggggatggaact
aacttgtatggcgcacagacattcttcctgtgccttgaagatgctagtggattgtccttt
ggagtgtttctgatgaacagcaatgccatggacgttgtcctccagcccacaccagctatc
acttaccgcaccaccgggggcgttcttgacttctacgtgttcttgggaaacactccagag
caagtggttcaagagtatctagagctcattggacggccagccatgcccgcatattgggca
cttggatttcatctcagtcgttatgactacgaatccctggataaactgaaacaggtcgtg
gagagaaaccgggccgcacaactcccttatgacgttcagcacgctgacattgattatatg
gataagaggagggacttcacttataatccagtagagtttaaaggctttcctgagtttgct
gaggagttacacaataacggacagaaactggtcatcattgtggacccagctatctccaac
acgtcatccccaagtgatccctacggcccgtatgacaggggttcagacatgaagatatgg
gtgaatgctccagatggagtgactccactcattggggaggtctggcctggaaaaactgtg
tttcctgattacaccaaccccaggtgtgctgtttggtgggcagaggaatttaagcttttt
cacaatcaagtgaagttcgatggaatctggattgatatgaatgaagtctccaacttcgtt
gatggttcagtttcaggatgttccacaagcagtctgaattatcctccattcacgcccaga
gtcctggatgggtacctgttcagcaagactctctgcatggatgccgtgcagcactggggc
aagcagtatgatgtccacaacctctacggctactccatggccattgccactgcagaggcc
gtcaagaccgtgttcccagataagagaagcttcattgtaacccgttctaccttcgcggga
tcgggcaagtttgcagcccattggttaggagacaatgcggccacctgggacgacctgcgg
tggtccatccccggcatgctcgagttcaacctttttggtgtcccaatggtgggtcctgac
atatgtggctatgctctggatgcccctgaggagctctgcagacggtggatgcagctggga
gccttctatccgttttccaggaatcacaatggtcaaggctacaaggcccaggatcctgcc
tcctttggagctgactctctgctgctgaattcctccaggcactacctgaccatccgctat
actctattgccctatctttacaccctcttctatcgcgctcacagatggggggagacagtg
gccaggcctcttctgcatgagttttatggggacagtagcacttgggacgtgcaccagcag
tttctctgggggcccggcctcctcatcactccagtgctgaatgagggtgcagagaaagtg
atggcatatatgccggatgccgtctggtacaattatgagactgggggccgagtgagatgg
agaaagcaaaaagtggagatggaccttcctggagacaaaattggacttcacctccgagga
ggctgcatcttccctatccaacagccagccacaaccactgtggccagtcggcggaaccct
ctgggtcttatcattgccctagacgagaacaaagaagcaaaaggcgaacttttctgggac
gacggggaaaccaaagatactgtggccaataaagtttatctcctctgtgagttttccgtc
acccaaaaccgcttggaggtgaagattttgcaatcaacctacaaagatcctaataatcta
gtatttaaagagattaagatcctcgggacccaggaaccgaagaacgttatagtgaaacac
aacaacgtccagagtcaagtttctcctaatgtcacatatgacagtaacctacaggttgcc
gttatcacagggctggatcttgtcctgggagaagcatacacagtggagtgggacctgacg
atcagggatgcggacaaaatagactgttatcctgatgagaagggtgcttctgcagaaagc
tgtgctgcccgtggctgtgcctgggaggaatccagttctccaggagtccctttttgctac
ttcaccaatgacctatactctgtcagtgacattcagtatgactcacacggggccacggct
gtcctctccttgaagtcccctgtttatgccaactctttgccctcaacacccgtgaacacc
ctccatctgaaggtgacctaccacaaggatgagatgctgcagttcaagatttatgatccc
aacaacagtcggtatgaagtcccagtccctctgaacttacccggggctccgtcaagcact
tttgagagtcgactctatgatgtcctcattacgaatccatttgggattgcagttcgccgg
aagagtacaggcaccgtgatttgggactctcagctcctcggcttcaccttcaatgacatg
ttcattcgcatctccactcgccttccctcccagtacgtctatggctttggggaaactgag
cacacagcctatcggagagacttgaactggcacacgtgggggatgttctcccgagaccaa
cccccagggtacaagaagaattcctatggcgtccacccctactacatggcactggaagaa
gatggcagcgcccatggggtgctcctgctaaacagcaatgccatggatgtgacattccag
cccatgcctgccttgacgtaccgtaccacaggaggaattctggatttttatttgttcctg
gggccaactccagagcttgtcactcagcagtacacggagatgattggtcggccagtgatg
gttccttactggtccttggggtttcagctgtgccgctatggataccgcaatgacgctgag
attgccagcttatatgatgagatggtggctgctcagataccctatgacgtgcagtactcg
gacatcgactacatggagcggcagctggactttaccctcagccccaacttcaccgggttt
ccagctctgatcactcgcatgaagaaggacgggatgcgtgtcatcctcatcctggaccca
gccatttccggaaatgagacggacacttatcttgcattcgagcggggtgtgaaggataac
gtctttatcaaagatccaactagtggagacattctctggggaaaggtttggcctgatctt
ccaaacatcgttataaacagttctctagactgggacagtcaagtggagcaataccgagct
tatgtggccttcccagactttttccgtaattcaactgccacctggtggaagagggagttg
caagaactctacacgaatccccgggagccagagaagagtttgaagtttgatggcatgtgg
attgatatgaatgaaccatcaagctttgtgaacggggcagttcctccaggctgcaaaaat
gccactctgaaccaccctccgtatatgccacatctggagtccagggacagaggcctgagc
agcaaaacgctgtgcatggagggtgagcagatcctgccagacggctccccggtgcgacat
tatgacgtgcacaacctgtacgggtggtcccagaccagacccacctacgaagctgtgcag
gaggtgacgggacaacgagggatcgtcatcacccgctccacgttcccctcttctggccgc
tggggaggccactggctgggagacaacacggccgcgtgggaccagctgaagaagtccatc
attggcatgatggagttcagcctctttggcatatcctatacaggagcagatatttgtggg
ttctttcaagacgctgaatatgagatgtgtgctcgctggatgcaactgggggccttttac
ccctttgcaaggaaccacaacaccattgggacaaggaggcaagaccctgtgtcctgggat
gatgcctttgtgagtatctccagaagcgtcctgcagaccagatacaccctcctgccgtat
ctctacaccctgatgcacttggcctacaccgagggcaggactgtggtgcggcctcttctc
catgagtttgtgtcaaaccgggtgacctgggatatagaccgtcagttcctgctgggcccc
gccttcctcgtcagccctgtcctggagcccaatgccagaaatgtcactgcatacttccct
agagcccgctggtatgattactacacgggtgaggacatcaaagtaagaggggagtggacg
tccttgccagccccccttgaccacatcaatcttcatgtccgcgggggcttcatcctgccc
tggcaggagcctgcacagaacacccacctcagccgccagaaattcgtaggcctcaaggtt
gccttggatgacaacgggactgcggaaggttggctcttctgggatgatgggcaaagtatc
ggtacctatgagaaaggactctattacctggcccgcttttctgccagccagaatacagtg
gagagtcacataattttcaacaaatacatcactgatacaaaccctttgaaacttggctac
atcgacatctggggagtggacagtccctccatttccaacgtcagcatctctgtgagcggc
acagttgtaacacccaccttcacctacatcgctacagcacaggtgttaaaaattgagatg
accagcaaaaacatcagcctacataatttcatttcattgacatggagaagtactcagtga

DBGET integrated database retrieval system