KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109457883Help
Entry
109457883         CDS       T04863                                 

Gene name
ELOVL1
Definition
(RefSeq) elongation of very long chain fatty acids protein 1 isoform X1
  KO
K10247  elongation of very long chain fatty acids protein 1 [EC:2.3.1.199]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00062  Fatty acid elongation
rss01040  Biosynthesis of unsaturated fatty acids
rss01100  Metabolic pathways
rss01212  Fatty acid metabolism
Module
rss_M00415  Fatty acid elongation in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09103 Lipid metabolism
   00062 Fatty acid elongation
    109457883 (ELOVL1)
   01040 Biosynthesis of unsaturated fatty acids
    109457883 (ELOVL1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:rss01004]
    109457883 (ELOVL1)
Enzymes [BR:rss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.199  very-long-chain 3-oxoacyl-CoA synthase
     109457883 (ELOVL1)
Lipid biosynthesis proteins [BR:rss01004]
 Elongase
  PUFA
   109457883 (ELOVL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ELO
Motif
Other DBs
NCBI-GeneID: 109457883
NCBI-ProteinID: XP_019606646
LinkDB All DBs
Position
Unknown
AA seq 296 aa AA seqDB search
MLSARTGTRTKRKSLARMEAVVNLYQEMMKYGDSRIQSYPLMGSPLLMTSILLTYVYFVL
SLGPRIMANRKPFQLRGFMVVYNFSLVALSLYIVYEFLMSGWLSSYTWRCDPVDFSNNPE
ALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFLHVFHHSVLPWSWWWGIRIAPGGM
GSFHAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHMTAIQLIQFVLVSLHISQYYFMP
SCNYQYPVIIHLIWMYGTIFFMLFSNFWYQSYTKGKRLPRSAQQNGAPGTTKVKAN
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgctttctgccaggactgggacaagaacaaaaagaaagtctttagccaggatggaggcc
gttgtgaatttgtaccaggagatgatgaagtacggagattcccggatccagagctaccct
ctgatggggtcacccctgctaatgacctccatcctcctgacttacgtgtacttcgttctc
tcacttgggcctcgcatcatggccaatcggaagcccttccagctgcgtggcttcatggtt
gtctacaacttctcactggtggcactgtccctctacattgtctatgagttcctgatgtct
ggctggctaagtagttacacctggcgctgtgaccctgtggatttttccaacaacccagag
gcactgaggatggttcgagtggcttggctcttcctcttctccaagttcattgagttgatg
gacacggtgatctttattctccggaaaaaagatggacaggtgaccttcctacatgtcttt
caccactcagtgcttccctggagctggtggtgggggataagaattgccccaggaggaatg
ggctctttccatgccatgataaactcctctgtgcatgtcgtcatgtacttgtactatgga
ttgtctgccctcggccctgtggctcaaccctacctttggtggaaaaagcacatgacagcc
atccagctgatccagttcgtcctggtctcgctgcacatctcccagtactacttcatgccc
agctgtaactaccagtacccagtcatcatccacctcatctggatgtacggcaccatcttc
ttcatgctcttctccaatttctggtatcagtcttacaccaaaggcaaacggctgccccgt
tcagctcagcaaaatggagctccaggtaccaccaaagtcaaggccaactga

DBGET integrated database retrieval system