KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109458539Help
Entry
109458539         CDS       T04863                                 

Gene name
MAP3K14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss04010  MAPK signaling pathway
rss04064  NF-kappa B signaling pathway
rss04210  Apoptosis
rss04380  Osteoclast differentiation
rss04625  C-type lectin receptor signaling pathway
rss04660  T cell receptor signaling pathway
rss04668  TNF signaling pathway
rss04672  Intestinal immune network for IgA production
rss05166  Human T-cell leukemia virus 1 infection
rss05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:rss00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109458539 (MAP3K14)
   04064 NF-kappa B signaling pathway
    109458539 (MAP3K14)
   04668 TNF signaling pathway
    109458539 (MAP3K14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    109458539 (MAP3K14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    109458539 (MAP3K14)
   04660 T cell receptor signaling pathway
    109458539 (MAP3K14)
   04672 Intestinal immune network for IgA production
    109458539 (MAP3K14)
  09158 Development
   04380 Osteoclast differentiation
    109458539 (MAP3K14)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    109458539 (MAP3K14)
   05169 Epstein-Barr virus infection
    109458539 (MAP3K14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rss01001]
    109458539 (MAP3K14)
Enzymes [BR:rss01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     109458539 (MAP3K14)
Protein kinases [BR:rss01001]
 Serine/threonine kinases: STE group
  Other
   109458539 (MAP3K14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH
Motif
Other DBs
NCBI-GeneID: 109458539
NCBI-ProteinID: XP_019607877
LinkDB All DBs
Position
Unknown
AA seq 948 aa AA seqDB search
MAVMEMACPGAPGSAVGQQKELAKAKEKTQAMGKKQSSINKLEAVEKSPVFCGKWEILND
VITKGTAKEGSEGGQAAISIIAQAECENSQEFSPTFSERIFIAGSKQYSQSESLDQIPNN
VAHATEGKMARVCWKGKHRSKARKKRKKKSSKSLAQVGVALARPLPRTPEQESCTVPVQE
DESPLGAPYVRNAPQFTKPLKEPDLGPLCFKKLGEGFRPALPRSELHKLISPLQCLNHVW
KLHHPQDAGPLPQPAHPFPYSRLPHPFPFHPLQPWKPHPLESFFLGKLACVDSQQPLPGP
PLGKLACIDSQKPLPGPPLEPSCPPRGTCEKFSVEEYLVHALQGSVSPGQAHSLTSLAKT
WSVGGSRPQEPSPKTEDSEGVLLTEKLKPVDYEYREEVHWATRQPCLGRGSFGEVHRMED
KQTGFQCAVKKVRVDVFRAEELIACAGLTSPRIVPLYGAVKEGPWVNIFMELLEGGSLGQ
LIKQKGCLPEDRALYYLGQALEGLEYLHTRRILHGDVKADNVLLSNDGSRAALCDFGHAV
RLRPDGLGKSLLTGDYIPGTETHMAPEVVMGKPCDAKVDVWSSCCMMLHMLNGCHPWTQY
FRGPLCLKIASEPPPVREIPPSCTPLTAQALEEGLRKEPVHRASAVELEGKVSLALQHVG
GLKSPWRGEYKEPRHPPPRPAHSHQTLSVQPSELSPGALGPQPADDTAGGAPKLQPPLPP
DPPERNKYPSLNWGKEESGTWEPLPLSSLDPAPTKNPSSPERKATFPEQELQQLEIELFL
NSLSQPFSLEEQEQILSCLSVDSLSLSDDSEKNPSKASQSSRDTLSSGVHSWSSQAEARS
SSWNMVLARGRPTDTPSYFNGVKVQIQSLNGEHLHIREFHRVKVGDIATGISSQIPATAF
SLVTKDGQPVHYDMEVPDSGIDLQCTLAPDGSFAWSWRVKHGQLENRP
NT seq 2847 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgatggaaatggcctgcccaggtgcccctggctcggcagtcgggcagcagaag
gagctcgccaaagccaaagagaagacacaggcaatggggaagaagcaaagctccatcaac
aagcttgaggctgtggagaagagccccgtgttctgtgggaagtgggagatcctgaacgac
gtgattaccaaaggcacagccaaggaaggctccgagggagggcaggccgccatctccatc
attgcccaggccgaatgtgagaatagccaagagttcagccccacattttcagaacggatt
ttcatcgctgggtcgaaacagtacagccagtctgagagcctcgatcaaatccctaacaat
gtggcccacgcaacagagggcaaaatggcccgggtgtgttggaaggggaagcatcgtagc
aaagcccggaagaaacgcaagaagaagagctcgaagtccctggctcaggtgggagtggcc
ttggccagacccctccccagaactcctgagcaggaaagctgcacagtcccggttcaggag
gatgagtccccacttggtgccccgtatgttagaaatgcaccccagttcaccaagcctctg
aaggagccagaccttggcccactctgttttaagaaactcggggagggcttccggcctgca
ctgcctcgatctgaactccacaaactgatcagccccttgcaatgtctaaaccatgtgtgg
aaactccaccacccccaggatgccggccccctgccccagcccgctcaccccttcccctac
agcaggctgccccatcccttcccatttcaccctctccagccctggaaacctcacccccta
gagtccttcttcctgggcaaactggcctgtgtagacagccagcagcccctgcccggccca
cccctgggcaaattggcctgtatagacagtcagaagcccctgcctggtccacctctggag
cccagctgcccacctcgcggcacgtgtgagaagttttctgtggaagagtacctggtacac
gctctgcaaggcagcgtgagccccggccaggcccacagcctgacgagcctggccaagacc
tggtcggtggggggctccaggccccaagagcccagccccaaaactgaggacagcgagggg
gtcctgcttactgagaaactgaagccagtggattatgagtaccgagaggaggtccactgg
gccacgcggcagccctgcctgggcaggggctccttcggagaggtgcacaggatggaggac
aagcagactggcttccagtgtgcagtcaaaaaggtgcgagtcgatgtgttccgggcagag
gagttgatagcatgtgcaggattgacctcgcccagaatcgtccccttgtatggagcagtg
aaggaaggtccttgggtcaacatcttcatggaactgctggaaggtggctcgctgggccag
ctcataaagcagaagggctgtctgccggaggaccgagccctttactatctgggccaggcc
ctggaagggctggaatacctccatacccgcaggattctacacggcgatgtcaaagctgac
aatgtgcttctgtccaatgacgggagccgtgcagccctctgcgactttggccatgctgtg
cgccttcgacctgatggcctagggaagtccttgctcacaggggactacatccctggcaca
gagacacacatggctccagaggtggtgatgggtaagccctgtgacgccaaggtggacgtc
tggagcagctgttgcatgatgctacacatgctcaatggctgccacccttggacccagtac
ttccgagggccgctctgcctcaagattgccagcgagcctccgcctgtgagggagatcccc
ccatcctgcacccctctcacagcccaggccttagaggaggggctgaggaaagagcctgtt
caccgagcgtccgcagtggagctggaggggaaggtcagcctggcattgcagcacgtggga
ggtctgaagagcccttggaggggagagtataaagagccaagacatccaccgccacgccca
gcccactctcatcagactctgagtgtccagccaagcgagctgtcaccaggggccctggga
ccccaaccagctgacgacacagcaggcggggcgcccaagctccagcctcctctaccccca
gaccccccagagcggaacaagtatccaagcttgaactggggcaaggaggagtctgggaca
tgggaacccttgcctctgtcctccctggacccggcccccaccaaaaaccccagctcacca
gagcggaaggcaacctttccggagcaggaactgcagcaactggaaatagaactatttctc
aacagcctatcccagccattttctctggaggagcaggagcaaattctctcgtgcctcagt
gtcgacagcctctccctgtcagatgacagtgaaaagaacccgtccaaggcctctcagagc
tcgcgggacaccctgagctccggcgtgcactcgtggagcagccaggccgaggctcgcagc
tccagctggaacatggtgctggcccggggacggcccactgacactccgagctatttcaat
ggtgtgaaagtccaaatccagtctctcaatggcgaacacctgcacatccgggagttccac
cgggttaaggtgggagacatcgccactggcatcagcagccagatcccagccacagccttc
agcttggtgactaaggacgggcaacctgtgcattacgacatggaggtgccagactcgggc
atcgatctgcagtgcaccctggccccagatggcagcttcgcctggagctggagggtcaag
catggccagctggagaacaggccctaa

DBGET integrated database retrieval system