KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109458737Help
Entry
109458737         CDS       T04863                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1 isoform X1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss03030  DNA replication
rss03410  Base excision repair
rss03420  Nucleotide excision repair
rss03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:rss00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    109458737 (LIG1)
   03410 Base excision repair
    109458737 (LIG1)
   03420 Nucleotide excision repair
    109458737 (LIG1)
   03430 Mismatch repair
    109458737 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:rss03032]
    109458737 (LIG1)
   03400 DNA repair and recombination proteins [BR:rss03400]
    109458737 (LIG1)
Enzymes [BR:rss01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     109458737 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     109458737 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     109458737 (LIG1)
DNA replication proteins [BR:rss03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    109458737 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     109458737 (LIG1)
DNA repair and recombination proteins [BR:rss03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     109458737 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     109458737 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     109458737 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DDR
Motif
Other DBs
NCBI-GeneID: 109458737
NCBI-ProteinID: XP_019608175
LinkDB All DBs
Position
Unknown
AA seq 921 aa AA seqDB search
MQRSIMSFFYPKKEDKTKKPEKEMSSSIRETEPPPKVALKERNREVPDSDSPVKKPGRKA
ARVLCSEEEEEDEALMSPKSQKPALDSAQVSSRSPVTFPESSRPLSSTSPTRTSPSGIPK
RRTARKQLSKRTIQNVLEEQSEDKDGDTKRKKEEGEAESLPEPEEAIEKETEEGDSPTAT
PEPPETCRAEPPTESSSEPGVAIKQEPQEEDPAKPPRPPRTLSSFFTPRKPAVKKEVKEE
ESVTPIKEEPKGLSPSNVSSSPLDPCSYNPAKNNYHPVEDACWGPGQKVPYLAVARTFEK
IEEVSARLRMVETLSNLLRSVVALSPPDLLPIIYLSLNHLGPPQQGLELGVGDGILLKAV
AQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPALTASGVFAKFRDIARLTGSA
STTRKMDIIKGLFVACRHSEARFIARALSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPP
AVVDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIVPVLLQHGLERLPEHCRLSPGV
PLKPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHVLEGGEVKIFSRNQEDNTGKY
PDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDAAEIQVQVCLY
AFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDMDQIAEFLEQSVRDS
CEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGF
LLASYDEESEELQAICKLGTGFSDEELEEHHQSLQALVLPSPRSYVRADGAVAPDHWLEP
SAVWEVKCADLSLSPIYPAARGLVDSEKGISLRFPRFIRIREDKKPEEATTSAQVAYLYR
KQSQIQKQHSADSDSDLEDFY
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttctaccccaagaaagaggacaaaacgaagaagcca
gagaaggagatgtctagcagcatcagagagacggagcccccaccgaaggtggcactgaag
gaacggaatagagaggtgcccgacagtgactctccagtgaagaagccgggcaggaaggcg
gcccgggtcctgtgcagtgaagaggaggaagaggacgaagccctcatgtcccccaaaagt
cagaagccagccctggactctgcacaagtttcctctcgcagtccggtcacgtttcctgag
agcagccgtcccctctccagtacctctccaacacgcacctccccgtcagggatcccaaag
cgtcgcacagctcggaagcagctttctaaacggacaattcagaatgttctggaagagcag
agcgaggacaaggacggagacaccaagaggaagaaggaggaaggagaagcagaaagcctc
ccagagccggaggaggccatagagaaggaaacagaagagggggactcacccacggcaact
cctgagcccccagagacctgcagagcagagcccccgacagaaagcagttcagagcctggt
gtggcgataaagcaggagccacaggaggaggatccggctaagccccccaggcctcccagg
acgctcagcagtttcttcaccccccggaagcccgcagtcaaaaaagaagtaaaagaagag
gagtctgttaccccaataaaggaggagcccaagggactctccccctcaaatgtgagctcc
agccccctggacccatgtagctacaaccctgccaagaacaactaccatcccgtagaagac
gcctgctgggggccgggccagaaggtcccttatttggctgtggcccggacctttgagaag
atcgaggaggtttctgctcggctccggatggtggagacgctgagcaacttgctgcgctct
gtggtagccctgtcacctccagaccttctccccatcatctaccttagtctcaaccacctt
gggccgccccagcagggcctggagcttggcgtcggggacggcatccttctcaaggcagtg
gcccaggccacaggtcggcagctcgagtctgtccgggctgaggcagccgagaagggcgac
gtggggctggtggccgagaacagccgcagcacccaaaggctcatgctgcccccgcccgcc
ctcaccgcctctggggtcttcgccaaattccgagacatcgcccggctcactggcagtgct
tccacaaccaggaagatggacatcatcaaaggcctctttgttgcctgccgccactcagaa
gcccgattcattgccagagccctgagtggacggctgcgcctcgggctggcagagcagtca
gtgctggccgccctctcccaggctgtgagcctcacacccccaggccaagaattcccccca
gccgtggtggatgcagggaagggcaagacagcagaggccagaaagacgtggctggaggag
caaggcatgatcctgaagcagacgttctgtgaggtgcctgacctggaccggattgtccct
gtgctgctgcagcacggcctggagcggctcccggagcactgccggctgagtccaggggtc
cccctaaagccaatgttggcccacccgaccaggggcgtcagtgaggtcctgaaacgcttc
gaggaggcagctttcacctgcgagtacaaatacgatgggcagagggcacagatccatgtt
ttggaaggtggggaggtgaagatctttagcaggaatcaggaagacaatactggaaagtac
cccgacatcatcagccgcatccccaagattaaacttccgtcagtcacatcttttatcctg
gacactgaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctc
accacccgcaaacgcaaggaggtggatgcagccgagatccaggtgcaggtgtgtctgtat
gccttcgacctcatctacctcaacggagagtctttggtacgtgagcccctttcccgacgc
cggcagctgctccgggagaactttgtggagacggagggcgagtttgtcttcgctacctcc
ctggacaccaaggacatggaccagattgccgagttcttggagcagtccgtgagagattcc
tgcgaggggctcatggtgaaaaccctggatgttgatgccacctacgagatcgccaagaga
tcacacaactggctcaagctgaagaaggactacctggacggtgtgggcgacaccctggac
ctcgtggtgattggtgcctacctgggccgcggaaagcgagctggccgctatgggggcttc
ctgctggcctcttacgacgaggaaagtgaggagctccaggccatttgcaagcttggaact
ggcttcagtgacgaggagctggaggaacatcaccagagcctgcaggccttggtgctgccc
agcccacgctcctacgtccgggcggacggcgccgtggcccccgaccactggctggagccc
agcgccgtgtgggaggtcaagtgcgccgacctctccctctcccccatctaccctgctgcc
cggggcctggtggacagtgagaaggggatctcccttcgctttcctcggtttattcgcatc
cgtgaggacaagaagccggaggaggccaccaccagtgcccaggtggcctatctgtatagg
aagcaaagtcagattcagaagcagcacagcgcagactccgactccgacctggaggatttc
tactag

DBGET integrated database retrieval system