KEGG   Rhinolophus sinicus (Chinese rufous horseshoe bat): 109458977Help
Entry
109458977         CDS       T04863                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase [ubiquinone] iron-sulfur subunit, mitochondrial
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
rss  Rhinolophus sinicus (Chinese rufous horseshoe bat)
Pathway
rss00020  Citrate cycle (TCA cycle)
rss00190  Oxidative phosphorylation
rss01100  Metabolic pathways
rss01200  Carbon metabolism
rss04714  Thermogenesis
rss04932  Non-alcoholic fatty liver disease (NAFLD)
rss05010  Alzheimer disease
rss05012  Parkinson disease
rss05016  Huntington disease
Module
rss_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rss_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
rss_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:rss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    109458977 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109458977 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    109458977 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    109458977 (SDHB)
   05012 Parkinson disease
    109458977 (SDHB)
   05016 Huntington disease
    109458977 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109458977 (SDHB)
Enzymes [BR:rss01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     109458977 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_9 Fer4_18
Motif
Other DBs
NCBI-GeneID: 109458977
NCBI-ProteinID: XP_019608644
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
MAAVVGVSLRRRFPATALGGACLQACRGAQTAAAAAPRIKKFAIYRWDPDKTGDKPHMQT
YEIDLNKCGPMVLDALIKIKNEMDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEDREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDEFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASA
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcggagtctccttgaggcgacggttcccggccacagcccttggcgga
gcctgcctgcaggcctgccgaggggcccagacagctgcagccgcagctccccgaatcaag
aaatttgccatctaccgatgggacccagacaagactggagataaacctcatatgcaaact
tatgagattgatttgaataaatgtggtcctatggtgttggatgctttaatcaagattaag
aatgaaatggattctaccttgaccttccgaagatcgtgcagagaaggtatctgtggctcc
tgtgcaatgaacatcaatgggggcaacactctagcttgcacccggaggattgacaccaac
ctcaacaaagtgtccaaaatctaccctctgccgcatatgtatgtgataaaggatcttgtt
cctgatttgagcaacttctatgctcagtacaaatccattgagccttatttgaagaaaaag
gatgaatcccaggaaggcaagcagcagtatctgcagtccatagaagatcgggagaaactg
gatggcctgtatgagtgcattctctgtgcctgctgcagcaccagctgccccagctactgg
tggaatggagacaaatacttggggcctgcggttcttatgcaggcctatcgctggatgatc
gactccagagacgagttcacagaggagcgcctggccaagctgcaggacccgttctctctg
taccgctgccacaccatcatgaactgcacacggacctgtcccaaggggctgaatccaggc
aaagctattgctgaaatcaagaaaatgatggcaacctacaaggagaagaaagcttcagct
taa

DBGET integrated database retrieval system