KEGG   Rummeliibacillus stabekisii: ATY39_00635Help
Entry
ATY39_00635       CDS       T04369                                 

Definition
(GenBank) aquaporin
  KO
K02440  glycerol uptake facilitator protein
Organism
rst  Rummeliibacillus stabekisii
Brite
KEGG Orthology (KO) [BR:rst00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:rst02000]
    ATY39_00635
Transporters [BR:rst02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    ATY39_00635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-ProteinID: AMW98049
UniProt: A0A143H9B9
LinkDB All DBs
Position
156481..157311
Genome map
AA seq 276 aa AA seqDB search
MTPFWGEMLGTMILVVFGAGVCAGANLNKSFAKNGGWVVISLAWGLAVTMGVFAVGSISG
AHLNPAVTIGLAMNGDFPWADVPKYILGQMIGAILGSVLIYLHYLPHWKATDDPAAKLGV
FATGPAIPHTFSNLLSEMIGTFILVLGLDFIGANKFSEGLNPLAVGSLIVVIGMSLGGTT
GYAINPARDLGPRIAHAILPIAGKGGSNWGYAWIPVVGPILGGSLGALFFKAAFKGELTG
LFWIVLIVVIVLLVLCYIFGEKGKIAHDPKTAKINE
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgacaccattttggggtgaaatgttaggtactatgattttggttgtatttggcgcaggg
gtttgcgccggtgctaatctaaacaaatctttcgcaaaaaatggaggatgggttgtcatt
tcgttggcctgggggcttgcggtgacaatgggggtatttgcagtcggcagtataagtggc
gcgcatttaaatccagctgtaaccattggcttagcgatgaacggtgattttccttgggca
gatgtaccaaagtatattctgggtcaaatgattggagctattttaggatcagtgttaatc
tatcttcattatctaccacattggaaagcaacagatgatcctgccgctaaattaggtgta
tttgctactggaccagcaataccacatacattttcaaatcttttaagcgaaatgattggt
acatttattctggtgttaggcttagactttatcggggcaaacaaattctcagaagggcta
aatccattagctgtaggttccttgattgtcgtaattgggatgtcgcttggcggaactaca
ggttatgcgatcaatcctgcccgtgatctcggtcctcgtattgctcatgccatcttaccg
attgctggtaaaggcggatctaactggggatatgcttggatcccggttgttgggccaatt
ctaggtggttcactcggtgcacttttctttaaagcagcatttaaaggagaactaactggt
ttattctggattgtacttatcgtggttatcgtgttgctagttctgtgctatatctttggc
gagaaagggaaaatagcacacgatcccaaaacagctaaaataaatgaataa

DBGET integrated database retrieval system