KEGG   Rummeliibacillus stabekisii: ATY39_00865Help
Entry
ATY39_00865       CDS       T04369                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00010  Glycolysis / Gluconeogenesis
rst00071  Fatty acid degradation
rst00280  Valine, leucine and isoleucine degradation
rst00310  Lysine degradation
rst00330  Arginine and proline metabolism
rst00340  Histidine metabolism
rst00380  Tryptophan metabolism
rst00410  beta-Alanine metabolism
rst00561  Glycerolipid metabolism
rst00620  Pyruvate metabolism
rst00625  Chloroalkane and chloroalkene degradation
rst00903  Limonene and pinene degradation
rst01100  Metabolic pathways
rst01110  Biosynthesis of secondary metabolites
rst01120  Microbial metabolism in diverse environments
rst01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ATY39_00865
   00053 Ascorbate and aldarate metabolism
    ATY39_00865
   00620 Pyruvate metabolism
    ATY39_00865
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ATY39_00865
   00561 Glycerolipid metabolism
    ATY39_00865
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATY39_00865
   00310 Lysine degradation
    ATY39_00865
   00330 Arginine and proline metabolism
    ATY39_00865
   00340 Histidine metabolism
    ATY39_00865
   00380 Tryptophan metabolism
    ATY39_00865
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ATY39_00865
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ATY39_00865
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ATY39_00865
Enzymes [BR:rst01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ATY39_00865
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: AMX00974
UniProt: A0A143HGX4
LinkDB All DBs
Position
212753..214180
Genome map
AA seq 475 aa AA seqDB search
MKSRLEHFINGEWVASTGSETIDVINPATEEVIGQISSGTEEDLDKAVAAAREAFPSFSQ
TSKQERIDLLNRIADEYEKRKDDIIETITQELGAPIKMSEKVHYNMGLSHFRQAAKELEA
LEFTEKRGSTLITKEAIGVSGLITPWNFPTNQTSTKLASAFAAGSTVVLKPSELTPFAAI
ILAEIFEAANVQKGVFNLVNGTGEVVGNGISSHPDIDFVSFTGSGAVGQKITENGAKTIK
KVALELGGKSPLIVLDDYDVKKAAKIAVGNILSNSGQVCAAATRTLIPQSMKDEFIEAVK
EVLPEFPVGDPYDRSTYLGPLVSEKQYNRVQDYIKKGQSEGATLVVGGTGKPEGLDKGYY
VKPTVFADVKNNMTIAQEEIFGPVMSILTYETLDEAIEIANDTIFGLAGYVVGEDNDTLL
KVASSIRAGRITINQVPADYAAPFGGYKQSGIGREWGVYGIEEYLEIKSIIGIPS
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctcgattagagcattttattaatggcgaatgggttgcatctacaggaagcgaa
acaattgatgtcattaatcctgcaacggaggaagtaattggccaaatcagcagtgggaca
gaggaagacctagataaagctgttgctgccgcacgggaggcttttccttctttttcacaa
acttcaaagcaagaacgcattgatttactaaaccgaattgcggacgaatatgaaaaacgc
aaagacgatattatagaaacgattacacaagaacttggtgcgccaataaaaatgagtgaa
aaagtacactacaatatggggctttctcactttagacaagcagctaaagagcttgaagct
ttagagttcaccgaaaaaagaggctccactcttattacaaaagaggcgatcggagtgtct
gggctaattacaccttggaatttcccaactaaccaaacttctacaaagcttgcaagtgcc
tttgcggcaggaagtacagttgttttaaaaccttctgagctaacaccttttgctgccatt
atcttggcagaaatctttgaagcagcaaatgtacaaaaaggagtgtttaaccttgtaaac
ggtacaggtgaagttgtcggaaatggcattagctctcaccctgatatcgactttgtttca
tttacaggttcaggtgctgtcggacaaaaaattactgaaaatggcgcaaaaacgataaaa
aaggtagcattagaacttggtgggaaatctcctcttattgttcttgatgattatgatgtg
aaaaaagctgcaaaaattgcagttggcaatattttatccaactcaggccaagtctgtgca
gctgcgacgcgcacgttaattcctcaatcaatgaaagatgagttcattgaggcagttaaa
gaggttcttccagaattcccagttggagatccatatgaccgcagcacgtacttagggcca
ctcgtatctgaaaaacaatataatcgagtacaggattatattaaaaaagggcaatctgaa
ggtgccacacttgttgtcggtggtacgggcaaacctgaaggattagataaaggctattat
gtaaagccaactgttttcgcggatgtgaaaaataatatgaccatagctcaagaggagatc
tttggtccagtaatgtctatcctaacctatgaaactcttgatgaagccattgagattgcg
aacgataccatttttggattagcaggttatgttgttggtgaagataatgacacattatta
aaagtggcttcttctatcagagcaggccgcatcactataaaccaagtaccagctgattat
gctgctccatttggcggctataagcaatcaggtatcggacgagaatggggcgtatacgga
atcgaagaatacttagaaattaaatcgattatcggtattccatcataa

DBGET integrated database retrieval system