KEGG   Rummeliibacillus stabekisii: ATY39_01140Help
Entry
ATY39_01140       CDS       T04369                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00473  D-Alanine metabolism
rst00550  Peptidoglycan biosynthesis
rst01100  Metabolic pathways
rst01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ATY39_01140
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ATY39_01140
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ATY39_01140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:rst01011]
    ATY39_01140
Enzymes [BR:rst01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ATY39_01140
Peptidoglycan biosynthesis and degradation proteins [BR:rst01011]
 Precursor biosynthesis
  Amino acid ligase
   ATY39_01140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 GARS_A RimK ATPgrasp_ST CPSase_L_D2 ATP-grasp ATP-grasp_4 Nuc_rec_co-act
Motif
Other DBs
NCBI-ProteinID: AMW98143
UniProt: A0A143H8S0
LinkDB All DBs
Position
complement(267656..268567)
Genome map
AA seq 303 aa AA seqDB search
MRVGVIMGGISSEKQVSIMTGEEMMIHLDKDKYEVVPIRIEKKEDLMEKARNLDVALLAL
HGKYGEDGTIQGTLDTLGVPYTGSNVLSSSLCMDKNISKKVIRYEGVQTPDWIHLSNTDE
LNLDELDKLGFPVVVKPNSGGSSVGVKIVYDKETVKSAIADVFKWDSEVIIEKVISGEEI
TCPILNGKLLPTISIRHQGEFFDYTSKYDDAATIEEVVQLPIETHNRVADAAISCYKALK
CSVYARVDMMIYNGVPYVLEVNTLPGLTKNSLMPKSAEAAGIPYSQLLDSIIESSLQARK
NEA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgagagttggcgtcattatgggagggatttcctccgagaaacaagtttcaatcatgaca
ggtgaagaaatgatgatacatttagataaagataaatatgaggtcgtaccgattcgtatt
gagaaaaaagaagacctaatggaaaaagcacggaatctggacgttgcactattggcgcta
catggtaaatatggtgaggatgggactattcaaggtactctagataccttaggcgttccc
tatacaggaagcaatgtcttgtccagcagcttatgtatggataagaatatatcgaaaaaa
gtcatcagatatgaaggcgtacaaacacccgattggattcacctttcaaacactgatgaa
cttaacctggacgaattagataaattgggtttccctgtagtggtgaaacctaattcaggc
ggttcgagtgtaggcgtaaaaatagtgtatgacaaggaaacagtgaaatcagcgatagca
gacgtattcaaatgggattcagaagtaattattgaaaaggttatatctggtgaggaaatc
acttgtcctatattgaatggaaagcttttaccgacgatttcaatccggcatcagggtgaa
ttctttgattacacctcgaaatatgatgatgcagctaccattgaagaagtggttcaactc
cctattgaaacacataatcgtgttgctgatgcagccatctcttgctataaggcattgaaa
tgtagcgtctatgcccgagtagacatgatgatttacaacggtgttccctatgtgttagaa
gttaatacgctgcctggattaacaaaaaatagtctaatgccgaaaagtgcagaagcagca
ggtataccttactctcaattgcttgattctattattgaaagttcacttcaagctaggaaa
aacgaagcttaa

DBGET integrated database retrieval system