KEGG   Rummeliibacillus stabekisii: ATY39_02400Help
Entry
ATY39_02400       CDS       T04369                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
rst  Rummeliibacillus stabekisii
Brite
KEGG Orthology (KO) [BR:rst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:rst01001]
    ATY39_02400
Enzymes [BR:rst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ATY39_02400
Protein kinases [BR:rst01001]
 Serine/threonine kinases: Other
  Bacterial family
   ATY39_02400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kdo Kinase-like APH RIO1 Seadorna_VP7 Pkinase_fungal Haspin_kinase Flexi_CP_N FTA2 Imm48 AgrB PIP49_C YrbL-PhoP_reg DUF1676 DUF2116
Motif
Other DBs
NCBI-ProteinID: AMW98379
UniProt: A0A143HAA5
LinkDB All DBs
Position
541638..543602
Genome map
AA seq 654 aa AA seqDB search
MLAGKRISGRYKILEVIGGGGMSNVYLAHDMILDRDVAIKILHYNFNDEQEMQRRFQREA
LSATSLTHPNIVSIYDVGEDGNMHYLVMEYVKGQTLKQYIQKYAPLAAAKSVQIMKQLTS
AIAHAHQNQIIHRDIKPQNILMDEEGNVKITDFGIAMALEDTSFTRTNSVLGTVHYLSPE
QARGGTATKKSDIYSLGILLYELLTGQLPFSGESAVSIALKHLQTETPSVRAIVPGIPQS
LENVVLKATAKDPVHRYQSVWEMAEDLETVLSDERSHEAKFQTPIDHDMTKVIPIIKEPV
EEKDLQKTMAMPIRDKAIEEPEQPIKKKQKKKKRKWLILSGLLIALVLILLSLLFVFPDL
FNEKRYPIPDVSKQQTDEAIANLKNAGFEIGEKAKQNSDDVKRNHIIMTSPGPDNERAKG
TKIDLVISKGPKKVEISNYTGKDIDQVKDLLERQGFKDVEVEEDYSDETEGIIIKQSIDE
GKKVVPGDTSIKLIVSKGQEQEHVSNLVGYDEEALNTYAKSSGFHIHIGSEKYSDDVPKG
QVISQSPSAGEALAVGSTIEVVLSKGPEEKPVKTYVKTVNIPYEKESEGEPQQVRIYIQD
KTHKIDDVYQEFQLFSSQEKRLQFEVEKGQQARYRIIRDDKVIIDETVSYDDLS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgctagctggaaaaagaattagcggccgctataaaattttagaagtaataggcggcgga
ggcatgtcgaatgtctacttggctcatgatatgattcttgaccgagatgttgctattaaa
atattgcattataattttaatgatgaacaagaaatgcaaagacggtttcaaagagaggcg
ctctctgctactagccttactcatccgaacattgtgagcatttatgatgttggcgaggac
ggcaatatgcactatcttgtaatggaatatgtgaaggggcaaacactgaaacaatacata
caaaaatatgccccgttagctgcagcgaaaagcgtccaaatcatgaaacaattaacttca
gcaattgctcatgcccatcaaaaccaaattatccaccgagatatcaaaccacaaaatatt
ttgatggatgaagaaggtaatgtgaagattacagactttggtattgcgatggctttagaa
gatacttcttttacacgtaccaattcagttttaggaactgttcattatttatcaccagag
caggcaagaggtggtacagctactaagaaatcggacatttattctttaggaatcctgtta
tatgaattattgacaggtcaattgccattttccggagaatcagcggtctcaattgcttta
aaacatttgcaaaccgaaacaccatctgtacgggcaattgtgccggggattcctcaaagt
ttagaaaatgtggtactaaaagcaactgccaaagaccctgtgcaccgttaccaatcagtg
tgggagatggcggaagatttagaaacagtcctttctgatgaaagaagccatgaagcgaaa
tttcagactccaattgatcatgatatgacaaaagttattccaatcattaaagaacctgtt
gaagaaaaagatttgcaaaaaacaatggcaatgcctatcagagacaaggcgatagaagaa
ccagaacaaccaattaaaaagaagcagaaaaagaagaaaagaaaatggttgattctcagc
gggttgctcattgcacttgtgcttattctactgtcgttattgtttgtctttccagatttg
ttcaatgaaaaaagatatccaattcctgacgtttccaaacaacagacagatgaggcaatt
gccaatttgaaaaatgcaggtttcgaaatcggtgaaaaagcaaaacaaaattcggacgat
gtgaaacgaaaccatattattatgacctcaccaggtccagataatgaaagagcaaaggga
acgaaaattgatcttgtcattagtaaagggcccaaaaaagtggagatctcaaattatacg
ggaaaagacattgaccaagtgaaggatcttctggaaagacaaggttttaaagatgtagag
gttgaggaagactattcagacgaaacggaaggtatcattatcaagcaatcgattgatgaa
ggcaagaaagtggtgccaggtgatacgtccattaaactgattgtcagcaaagggcaggaa
caagaacatgtttcaaatctcgtcggctatgacgaagaagctcttaatacctatgctaaa
agctctggattccacattcatattggcagcgaaaaatactcagatgatgttcctaagggt
caagtaatttcacaatctccttcagcaggtgaagcgttagctgtcggtagtacgattgaa
gtagttttatctaaaggacccgaagaaaagcctgtaaaaacatatgtaaaaacagtgaac
atcccttatgaaaaagagagtgaaggcgagccgcaacaagtacgtatttatattcaagat
aaaacgcataaaatagatgatgtttaccaagaatttcaattgttctcctcccaggaaaaa
cgattgcaatttgaagttgaaaaaggccagcaagcacgatacagaatcatacgggatgat
aaagtaattatagatgaaacggtttcttatgatgatttgtcataa

DBGET integrated database retrieval system