KEGG   Rummeliibacillus stabekisii: ATY39_08775Help
Entry
ATY39_08775       CDS       T04369                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00020  Citrate cycle (TCA cycle)
rst00190  Oxidative phosphorylation
rst00650  Butanoate metabolism
rst01100  Metabolic pathways
rst01110  Biosynthesis of secondary metabolites
rst01120  Microbial metabolism in diverse environments
rst01130  Biosynthesis of antibiotics
rst01200  Carbon metabolism
Module
rst_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rst_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ATY39_08775 (sdhB)
   00650 Butanoate metabolism
    ATY39_08775 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ATY39_08775 (sdhB)
Enzymes [BR:rst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ATY39_08775 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ATY39_08775 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4 Fer4_4 Fer4_21
Motif
Other DBs
NCBI-ProteinID: AMW99543
UniProt: A0A143HCS4
LinkDB All DBs
Position
complement(1774698..1775471)
Genome map
AA seq 257 aa AA seqDB search
MGNEAQKFVEVEVQRQDNADSNPYWEKFRVPYRPNMNVISVLMAIRENPVTTDGKQTTPV
SWDMNCLEEVCGACSMVINGRPRQSCSSLVDQLTQPIKLQPMSTFPIIRDLQIDRSRMFD
SLKKVKAWVPIDGSYDLGEGPRMPERKREWAYELSKCMTCGVCLESCPNVNSHSDFIGPA
PLSQVRLFNSHPTGAMNKDERLNAIMGDGGLASCGNAQNCVVACPKGIPLTTSIAALNRD
TTVQMFRNFFGSDHMVD
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgaagcgcaaaaatttgttgaagttgaagttcaacgacaagacaatgcggac
tctaacccttactgggaaaaattccgtgttccttatcgtccaaacatgaatgtaatctct
gtattgatggcaattcgggaaaatcctgtaacgactgacggcaaacaaacaacacctgtt
tcttgggacatgaactgtcttgaagaagtatgtggcgcttgttcaatggtaattaatgga
cgtccacgccaatcatgttcatcattggttgatcaattgacacaaccaattaaattacaa
ccaatgagtactttccctatcatccgcgacttgcaaattgaccgtagccgcatgtttgat
tcattgaaaaaagtcaaagcatgggttccaattgatggttcttatgatctaggcgaaggt
cctcgtatgccagaacgtaaacgtgaatgggcatatgaattgtctaaatgtatgacttgc
ggtgtctgcttagagtcttgtccgaatgtaaacagccattcagactttatcggccctgca
ccactatctcaagttcgtttattcaactcacacccaactggtgcgatgaacaaagacgaa
cgcctaaacgcgatcatgggcgatggtggacttgctagctgtggtaatgctcaaaactgt
gtagttgcatgtccaaaaggtattcctttgactacatcaattgcagcacttaaccgtgac
actacagttcaaatgttcagaaacttctttggttctgaccacatggtggactag

DBGET integrated database retrieval system