KEGG   Rummeliibacillus stabekisii: ATY39_08780Help
Entry
ATY39_08780       CDS       T04369                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
rst  Rummeliibacillus stabekisii
Pathway
rst00020  Citrate cycle (TCA cycle)
rst00190  Oxidative phosphorylation
rst00650  Butanoate metabolism
rst01100  Metabolic pathways
rst01110  Biosynthesis of secondary metabolites
rst01120  Microbial metabolism in diverse environments
rst01130  Biosynthesis of antibiotics
rst01200  Carbon metabolism
Module
rst_M00009  Citrate cycle (TCA cycle, Krebs cycle)
rst_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:rst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ATY39_08780 (sdhA)
   00650 Butanoate metabolism
    ATY39_08780 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ATY39_08780 (sdhA)
Enzymes [BR:rst01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ATY39_08780 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     ATY39_08780 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA AlaDh_PNT_C HI0933_like FAD_oxidored NAD_binding_8 Pyr_redox
Motif
Other DBs
NCBI-ProteinID: AMW99544
UniProt: A0A143HCU8
LinkDB All DBs
Position
complement(1775474..1777225)
Genome map
AA seq 583 aa AA seqDB search
MAKSKLIVVGGGLAGLMATMKAAEMGTEVELFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKAMCDAAPGIIHLFDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAFAGATTGQQLLYALDEQVRRWEVEGLVTKYEGWEFLGLVLDDEGVCKGIKAQDLT
THEIRAFRSDAVIMASGGPGIIFGKSTNSMINTGSAASIVYQQGAKYANGEMIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCINQK
LGVNGENVVYLDLSHKDPHELDVKLGGIIEIYQKFVGDDPHKVPMKIFPAVHYSMGGLWV
DYDQHTTIPGVFAAGECDYSQHGANRLGANSLLSAIYGGSVAGPNAVEYIRGLDKHVEDL
PSSLFDSAVKEEQEKWDEVLRLDGTENAYLLHKELGEVMTENVTVVRYNDKLEKTLVKLQ
ELKERYNNININDTSKWSNQGVQFTRQLKNMLALANVITKGALLRDESRGAHYKPDFPTR
DDANFLKTTIAEFTPSFDPKISYEEVDVSLIKPRERNYAKGSH
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaagcaaattgatcgtcgttggtggcggtttggccggcttaatggctactatg
aaagctgccgaaatgggcactgaagttgaattattctcgttagttccggtaaaacgctca
cactctgtttgtgcgcaaggcggaattaatggtgccgttaatacaaaaggtgaaggtgac
tcaccttggattcactttgatgatacagtgtatggtggggacttcttagcaaaccaacca
cctgtaaaagcaatgtgtgacgctgcacctggcattatccacttatttgaccgtatgggc
gttatgtttaaccgtaccccagaaggtttactagatttccgacgtttcggcggtacacaa
catcaccgtacagcatttgctggtgcgactactggtcaacaacttctttacgcacttgat
gaacaagttcgtcgttgggaagtagaaggactagtgactaagtatgaaggctgggaattc
cttggcttagttcttgatgatgaaggcgtttgtaaaggtattaaagcacaagaccttact
acacacgaaatcagagcattccgttctgacgctgtaatcatggctagtggtggtcctggt
atcatcttcggtaaatcaacaaactcaatgatcaacacaggttctgctgcatctatcgtt
taccaacaaggcgcaaaatacgctaacggtgaaatgattcaaattcacccaacagcaatc
ccaggcgatgacaaattacgtctaatgtctgaatctgctcgtggtgaaggcggtcgtatc
tggacttataaagacggtaaaccttggtacttcttagaagaaaaatatcctgcatacgga
aacttagtaccacgtgatattgcaacacgtgaaatctttgacgtatgtattaatcaaaaa
ttaggtgttaatggagaaaatgttgtataccttgacctttctcacaaagaccctcatgaa
ttagatgttaaacttggcggtatcatcgaaatttatcaaaaattcgttggtgatgaccca
cataaagtaccgatgaaaattttccctgctgttcactattcaatgggcggattatgggta
gattacgatcaacatacaactattcctggcgtatttgcagctggagaatgtgattactct
caacacggtgcaaaccgtcttggcgcgaactcactattgtctgctatttatggcggtagc
gtagctggtccaaatgcagttgagtacatccgtggacttgacaaacatgttgaagaccta
ccatcttctctatttgatagcgcagtaaaagaagaacaagagaaatgggatgaagtactt
cgtctagatggtactgaaaatgcttacttacttcacaaagaacttggagaagtaatgaca
gaaaacgtaacagttgttcgttacaacgacaaacttgaaaaaactcttgtgaaattgcaa
gaactaaaagaacgttataacaacattaatattaacgatacatctaaatggtcaaaccaa
ggtgttcaattcactcgccaattgaaaaacatgcttgcacttgcaaatgttattacaaaa
ggtgctttgcttcgtgacgaatcacgtggggctcactataaacctgatttcccaactcgt
gatgatgcaaacttccttaaaacaacaattgctgaattcacgccttcatttgatccaaaa
attagctacgaagaagttgatgtttcactaatcaaacctcgcgaacgtaactatgcgaaa
ggaagtcactaa

DBGET integrated database retrieval system